Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V1T7V4

Protein Details
Accession A0A1V1T7V4    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
67-86PPGLQIKDVPKKNKKGKHTABasic
NLS Segment(s)
PositionSequence
76-84PKKNKKGKH
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPQEIADIKRFIEICRRDDAKSARVKKSSKTSSKSSQTKFKVRCSKQLYTLVVKDNDKAEKLKQSLPPGLQIKDVPKKNKKGKHTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.38
3 0.4
4 0.37
5 0.44
6 0.47
7 0.45
8 0.5
9 0.55
10 0.53
11 0.57
12 0.59
13 0.57
14 0.63
15 0.65
16 0.64
17 0.61
18 0.61
19 0.63
20 0.71
21 0.73
22 0.67
23 0.67
24 0.64
25 0.68
26 0.65
27 0.66
28 0.67
29 0.61
30 0.66
31 0.64
32 0.61
33 0.58
34 0.61
35 0.54
36 0.48
37 0.48
38 0.43
39 0.4
40 0.37
41 0.32
42 0.28
43 0.27
44 0.24
45 0.24
46 0.23
47 0.27
48 0.29
49 0.34
50 0.36
51 0.4
52 0.44
53 0.43
54 0.48
55 0.45
56 0.43
57 0.4
58 0.37
59 0.4
60 0.44
61 0.5
62 0.52
63 0.57
64 0.67
65 0.74
66 0.8