Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4FEF2

Protein Details
Accession A0A0C4FEF2    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
108-135DRLQQHLSKRARWRERPRHQRCGPEPDRBasic
NLS Segment(s)
PositionSequence
70-128RHHRSRELLRPDRSRELLRPDRSREASKRHQLVGLPKPDRLQQHLSKRARWRERPRHQR
139-145PSKRRPW
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences SARTLGRPTTLRTGKPCPIHRTQSTGHYGCPQQPHAIPRSKCTRPSRAASLREPSVAGNSQNPGAAGAPRHHRSRELLRPDRSRELLRPDRSREASKRHQLVGLPKPDRLQQHLSKRARWRERPRHQRCGPEPDRQQEPSKRRPWRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.62
3 0.65
4 0.62
5 0.64
6 0.68
7 0.64
8 0.63
9 0.58
10 0.57
11 0.58
12 0.52
13 0.45
14 0.42
15 0.41
16 0.39
17 0.41
18 0.35
19 0.31
20 0.33
21 0.36
22 0.37
23 0.44
24 0.41
25 0.42
26 0.49
27 0.49
28 0.55
29 0.58
30 0.6
31 0.57
32 0.62
33 0.65
34 0.65
35 0.66
36 0.61
37 0.59
38 0.51
39 0.46
40 0.4
41 0.31
42 0.25
43 0.21
44 0.18
45 0.14
46 0.13
47 0.13
48 0.13
49 0.12
50 0.1
51 0.09
52 0.09
53 0.08
54 0.1
55 0.16
56 0.19
57 0.22
58 0.22
59 0.23
60 0.27
61 0.34
62 0.4
63 0.43
64 0.48
65 0.53
66 0.57
67 0.6
68 0.61
69 0.55
70 0.49
71 0.42
72 0.44
73 0.46
74 0.48
75 0.49
76 0.49
77 0.53
78 0.54
79 0.58
80 0.54
81 0.53
82 0.56
83 0.59
84 0.58
85 0.53
86 0.51
87 0.48
88 0.51
89 0.5
90 0.5
91 0.43
92 0.4
93 0.41
94 0.43
95 0.43
96 0.4
97 0.4
98 0.39
99 0.48
100 0.57
101 0.6
102 0.63
103 0.69
104 0.74
105 0.76
106 0.78
107 0.79
108 0.81
109 0.88
110 0.91
111 0.91
112 0.92
113 0.88
114 0.88
115 0.84
116 0.84
117 0.78
118 0.77
119 0.75
120 0.71
121 0.71
122 0.65
123 0.67
124 0.66
125 0.69
126 0.69
127 0.71