Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4FBV2

Protein Details
Accession A0A0C4FBV2    Localization Confidence High Confidence Score 19.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-34DTRSGKDHSKNPPPTKRSRGRRGRGGRTRGILBasic
134-164SKPAASGSKPKPYKRKPKKGENKWKETFRMAHydrophilic
NLS Segment(s)
PositionSequence
10-31HSKNPPPTKRSRGRRGRGGRTR
110-157NKKPAKESSERDPKKPYKIPKIDQSKPAASGSKPKPYKRKPKKGENKW
Subcellular Location(s) nucl 20, mito 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MVDTRSGKDHSKNPPPTKRSRGRRGRGGRTRGILNKAQEDAIAIFKATKAAYLNAKNYKEMDLLKSYLKQVISLFRVIQKFLPWKEILTKYSDGWNPYMERKHIKVLENNKKPAKESSERDPKKPYKIPKIDQSKPAASGSKPKPYKRKPKKGENKWKETFRMAQVLMEVKDAIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.79
3 0.82
4 0.85
5 0.86
6 0.86
7 0.86
8 0.87
9 0.86
10 0.89
11 0.9
12 0.9
13 0.9
14 0.86
15 0.82
16 0.75
17 0.73
18 0.68
19 0.63
20 0.58
21 0.51
22 0.47
23 0.42
24 0.38
25 0.3
26 0.26
27 0.21
28 0.18
29 0.14
30 0.1
31 0.09
32 0.09
33 0.11
34 0.09
35 0.1
36 0.09
37 0.12
38 0.19
39 0.23
40 0.29
41 0.35
42 0.36
43 0.36
44 0.36
45 0.35
46 0.31
47 0.28
48 0.25
49 0.2
50 0.21
51 0.21
52 0.22
53 0.21
54 0.21
55 0.19
56 0.17
57 0.15
58 0.19
59 0.19
60 0.19
61 0.18
62 0.2
63 0.21
64 0.2
65 0.19
66 0.18
67 0.21
68 0.21
69 0.24
70 0.2
71 0.2
72 0.25
73 0.28
74 0.25
75 0.24
76 0.25
77 0.21
78 0.26
79 0.27
80 0.22
81 0.2
82 0.21
83 0.19
84 0.21
85 0.23
86 0.21
87 0.24
88 0.24
89 0.3
90 0.32
91 0.34
92 0.37
93 0.46
94 0.54
95 0.57
96 0.63
97 0.6
98 0.57
99 0.55
100 0.53
101 0.5
102 0.47
103 0.44
104 0.47
105 0.54
106 0.56
107 0.57
108 0.62
109 0.6
110 0.62
111 0.65
112 0.64
113 0.64
114 0.71
115 0.73
116 0.73
117 0.78
118 0.74
119 0.74
120 0.71
121 0.63
122 0.56
123 0.53
124 0.46
125 0.37
126 0.41
127 0.4
128 0.44
129 0.48
130 0.54
131 0.62
132 0.69
133 0.8
134 0.81
135 0.87
136 0.86
137 0.9
138 0.94
139 0.94
140 0.95
141 0.95
142 0.93
143 0.91
144 0.89
145 0.82
146 0.77
147 0.72
148 0.66
149 0.63
150 0.53
151 0.46
152 0.41
153 0.41
154 0.35
155 0.3