Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V1T589

Protein Details
Accession A0A1V1T589    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
14-33TARVNKKRVSRTKGHLSRRTHydrophilic
55-79ELLRNSKDKRARKLAKKRLGSFQRGHydrophilic
NLS Segment(s)
PositionSequence
16-27RVNKKRVSRTKG
59-82NSKDKRARKLAKKRLGSFQRGKRK
Subcellular Location(s) nucl 11, mito 10, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MALARGLDKGHKTTARVNKKRVSRTKGHLSRRTAHVRDVVREVMGLAPYERRVIELLRNSKDKRARKLAKKRLGSFQRGKRKVDELQRVIAESRRAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.56
3 0.61
4 0.65
5 0.66
6 0.72
7 0.79
8 0.8
9 0.77
10 0.74
11 0.74
12 0.77
13 0.79
14 0.81
15 0.78
16 0.74
17 0.72
18 0.71
19 0.72
20 0.62
21 0.56
22 0.52
23 0.46
24 0.43
25 0.41
26 0.33
27 0.24
28 0.22
29 0.2
30 0.14
31 0.12
32 0.09
33 0.06
34 0.06
35 0.07
36 0.08
37 0.07
38 0.07
39 0.08
40 0.09
41 0.13
42 0.2
43 0.26
44 0.29
45 0.35
46 0.35
47 0.41
48 0.49
49 0.51
50 0.52
51 0.57
52 0.64
53 0.68
54 0.79
55 0.83
56 0.84
57 0.86
58 0.82
59 0.82
60 0.8
61 0.79
62 0.77
63 0.76
64 0.78
65 0.74
66 0.73
67 0.67
68 0.65
69 0.64
70 0.64
71 0.65
72 0.58
73 0.59
74 0.57
75 0.54
76 0.5
77 0.46