Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V1TF50

Protein Details
Accession A0A1V1TF50    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
238-259LDETRERIGRNKRGRDRENFDDBasic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 13, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025213  Sim4_Fta2  
Pfam View protein in Pfam  
PF13095  FTA2  
Amino Acid Sequences MTRHRGDSGHASKGLLPPDGGPSIREFKHPEAPIEWIKRLDNPDREYNEAFVYQVRIASQEYALKVFKFSNPKSNLFYWGTRLREKLPLKQAIFYTDPFYAECRAYGRIEDGKVDRHSRTPRVRQQIAVKCHGYLLLDDSDKRWLLDRGHDLETDLLDNDVREALEGDTRVRAIVKHLDKRPSLLHAGNIGRAWTSVHLLNKSLKIYNMDIKADNFIGFRLVDFGSSWTEPHEILRYLDETRERIGRNKRGRDRENFDDMIEEEEIPTRLKVVPTSRYQLRSGGEAPWAGRELPKRRRTMTGHE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.31
3 0.26
4 0.21
5 0.24
6 0.26
7 0.23
8 0.2
9 0.22
10 0.27
11 0.28
12 0.31
13 0.32
14 0.34
15 0.44
16 0.45
17 0.43
18 0.39
19 0.44
20 0.48
21 0.48
22 0.46
23 0.39
24 0.38
25 0.4
26 0.45
27 0.47
28 0.47
29 0.47
30 0.53
31 0.54
32 0.58
33 0.54
34 0.49
35 0.42
36 0.34
37 0.29
38 0.22
39 0.2
40 0.15
41 0.15
42 0.13
43 0.12
44 0.13
45 0.14
46 0.15
47 0.15
48 0.16
49 0.18
50 0.19
51 0.18
52 0.19
53 0.19
54 0.23
55 0.28
56 0.3
57 0.37
58 0.41
59 0.45
60 0.48
61 0.48
62 0.49
63 0.43
64 0.42
65 0.38
66 0.4
67 0.4
68 0.38
69 0.39
70 0.36
71 0.41
72 0.43
73 0.45
74 0.47
75 0.51
76 0.49
77 0.5
78 0.48
79 0.44
80 0.42
81 0.35
82 0.29
83 0.22
84 0.21
85 0.18
86 0.19
87 0.16
88 0.14
89 0.14
90 0.12
91 0.14
92 0.14
93 0.14
94 0.16
95 0.17
96 0.18
97 0.2
98 0.19
99 0.23
100 0.25
101 0.28
102 0.26
103 0.29
104 0.34
105 0.4
106 0.47
107 0.52
108 0.57
109 0.63
110 0.64
111 0.62
112 0.66
113 0.66
114 0.62
115 0.57
116 0.49
117 0.4
118 0.38
119 0.34
120 0.24
121 0.16
122 0.14
123 0.1
124 0.1
125 0.1
126 0.11
127 0.13
128 0.13
129 0.13
130 0.12
131 0.12
132 0.13
133 0.18
134 0.22
135 0.23
136 0.25
137 0.25
138 0.23
139 0.21
140 0.2
141 0.15
142 0.1
143 0.06
144 0.05
145 0.05
146 0.05
147 0.05
148 0.04
149 0.04
150 0.05
151 0.05
152 0.06
153 0.07
154 0.07
155 0.07
156 0.07
157 0.08
158 0.07
159 0.07
160 0.08
161 0.16
162 0.22
163 0.3
164 0.35
165 0.4
166 0.4
167 0.43
168 0.42
169 0.37
170 0.34
171 0.28
172 0.24
173 0.24
174 0.25
175 0.24
176 0.22
177 0.19
178 0.15
179 0.14
180 0.13
181 0.08
182 0.09
183 0.11
184 0.14
185 0.14
186 0.16
187 0.19
188 0.21
189 0.23
190 0.22
191 0.2
192 0.21
193 0.23
194 0.27
195 0.27
196 0.26
197 0.26
198 0.25
199 0.26
200 0.23
201 0.21
202 0.15
203 0.12
204 0.11
205 0.1
206 0.09
207 0.09
208 0.09
209 0.08
210 0.09
211 0.1
212 0.12
213 0.12
214 0.12
215 0.12
216 0.13
217 0.13
218 0.14
219 0.16
220 0.14
221 0.15
222 0.17
223 0.18
224 0.18
225 0.21
226 0.22
227 0.2
228 0.22
229 0.26
230 0.26
231 0.32
232 0.41
233 0.48
234 0.55
235 0.64
236 0.71
237 0.76
238 0.82
239 0.83
240 0.82
241 0.79
242 0.77
243 0.67
244 0.57
245 0.49
246 0.42
247 0.36
248 0.28
249 0.21
250 0.14
251 0.15
252 0.15
253 0.14
254 0.13
255 0.12
256 0.13
257 0.14
258 0.19
259 0.24
260 0.3
261 0.35
262 0.42
263 0.47
264 0.49
265 0.5
266 0.49
267 0.45
268 0.43
269 0.39
270 0.34
271 0.3
272 0.28
273 0.27
274 0.25
275 0.25
276 0.2
277 0.23
278 0.3
279 0.37
280 0.46
281 0.54
282 0.58
283 0.6
284 0.69