Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V1T9J9

Protein Details
Accession A0A1V1T9J9    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
51-71GEEYVKRSSSQKRRARRGGHRBasic
NLS Segment(s)
PositionSequence
59-71SSQKRRARRGGHR
Subcellular Location(s) cyto 14.5, cyto_nucl 12, nucl 6.5, mito 6
Family & Domain DBs
Amino Acid Sequences MIDACAEWAAAHPWCEEGSRVCRNFNPLEPRYSKVASDCGKADCVGACPRGEEYVKRSSSQKRRARRGGHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.14
4 0.15
5 0.21
6 0.29
7 0.3
8 0.31
9 0.32
10 0.36
11 0.37
12 0.39
13 0.41
14 0.34
15 0.39
16 0.4
17 0.41
18 0.4
19 0.38
20 0.32
21 0.24
22 0.29
23 0.24
24 0.24
25 0.22
26 0.19
27 0.19
28 0.19
29 0.18
30 0.11
31 0.13
32 0.14
33 0.14
34 0.13
35 0.14
36 0.14
37 0.17
38 0.19
39 0.18
40 0.2
41 0.27
42 0.29
43 0.3
44 0.35
45 0.43
46 0.52
47 0.6
48 0.64
49 0.66
50 0.75
51 0.83