Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V1TQF7

Protein Details
Accession A0A1V1TQF7   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
53-91ANGNRPKRGKKWKNDIVKKIRYSRKRWHPTKRPNMSNLMHydrophilic
NLS Segment(s)
PositionSequence
57-84RPKRGKKWKNDIVKKIRYSRKRWHPTKR
Subcellular Location(s) mito 12.5, nucl 10, cyto_mito 7.5, cyto 1.5
Family & Domain DBs
Amino Acid Sequences MRTDIYEFCLHSTEIFAGNVPFMQFGEYMSGSSVATAIRAGLSFLVISCHYLANGNRPKRGKKWKNDIVKKIRYSRKRWHPTKRPNMSNLMIFARLPKHLPEKPTCSLTTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.13
4 0.11
5 0.11
6 0.12
7 0.1
8 0.09
9 0.07
10 0.08
11 0.07
12 0.07
13 0.1
14 0.1
15 0.1
16 0.1
17 0.11
18 0.09
19 0.09
20 0.09
21 0.05
22 0.05
23 0.05
24 0.05
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.05
33 0.05
34 0.06
35 0.06
36 0.06
37 0.06
38 0.09
39 0.1
40 0.17
41 0.25
42 0.27
43 0.31
44 0.34
45 0.38
46 0.45
47 0.56
48 0.56
49 0.58
50 0.67
51 0.71
52 0.78
53 0.84
54 0.85
55 0.84
56 0.83
57 0.8
58 0.78
59 0.79
60 0.76
61 0.75
62 0.76
63 0.77
64 0.79
65 0.83
66 0.85
67 0.86
68 0.89
69 0.92
70 0.92
71 0.88
72 0.81
73 0.79
74 0.71
75 0.62
76 0.54
77 0.46
78 0.37
79 0.29
80 0.28
81 0.23
82 0.22
83 0.21
84 0.23
85 0.29
86 0.32
87 0.39
88 0.44
89 0.49
90 0.52
91 0.56