Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4FC89

Protein Details
Accession A0A0C4FC89    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
52-80ESDPEAKPKPRGRPRKQVLKEAAKRMKRSBasic
NLS Segment(s)
PositionSequence
26-28KGK
57-80AKPKPRGRPRKQVLKEAAKRMKRS
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences NAASPTPSTSKPWAITNHKGATGSKKGKAKADPPSEAKGETSPSEDSDIEFESDPEAKPKPRGRPRKQVLKEAAKRMKRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.52
3 0.55
4 0.53
5 0.49
6 0.48
7 0.44
8 0.43
9 0.45
10 0.42
11 0.4
12 0.43
13 0.44
14 0.48
15 0.51
16 0.5
17 0.5
18 0.52
19 0.51
20 0.5
21 0.51
22 0.46
23 0.41
24 0.35
25 0.26
26 0.21
27 0.17
28 0.15
29 0.13
30 0.12
31 0.14
32 0.14
33 0.13
34 0.13
35 0.13
36 0.11
37 0.11
38 0.1
39 0.09
40 0.1
41 0.1
42 0.12
43 0.14
44 0.15
45 0.24
46 0.31
47 0.4
48 0.5
49 0.61
50 0.67
51 0.76
52 0.83
53 0.86
54 0.85
55 0.85
56 0.84
57 0.84
58 0.84
59 0.83
60 0.84