Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q3E255

Protein Details
Accession A0A1Q3E255    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
223-245AVEFAKRHYGKKRGRRVVAEDSEHydrophilic
NLS Segment(s)
PositionSequence
232-237GKKRGR
Subcellular Location(s) nucl 12, mito 10, cyto 2, pero 1, golg 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MQRLGTISKTRVRYCTLSDDQIRYMNPDTFRDLNLSTYLTSYQFTTSAPDWARNKEILFPGLHSDIINLRGTTVQGWRMVPLYEEYLKLRASDQQFEDLRAFCWEMYDTLKWFPKVSRDRLIDNKKRTTWKQVFAGGLKSGTPITINPNFSKEPITALPNVPPVLSLRTPGDQDEESEMMGDQLSELRESHQETLLPIAQAVFGDVPQDEPPEPGPSQPSGMAVEFAKRHYGKKRGRRVVAEDSESENEGRRKGRVVHFVDLTGDDMEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.52
3 0.49
4 0.51
5 0.53
6 0.52
7 0.49
8 0.48
9 0.44
10 0.39
11 0.37
12 0.34
13 0.31
14 0.31
15 0.34
16 0.32
17 0.32
18 0.32
19 0.29
20 0.26
21 0.25
22 0.23
23 0.18
24 0.17
25 0.18
26 0.15
27 0.15
28 0.14
29 0.13
30 0.12
31 0.12
32 0.15
33 0.14
34 0.2
35 0.21
36 0.27
37 0.29
38 0.33
39 0.36
40 0.34
41 0.34
42 0.32
43 0.34
44 0.29
45 0.27
46 0.24
47 0.24
48 0.23
49 0.23
50 0.17
51 0.16
52 0.15
53 0.17
54 0.17
55 0.13
56 0.12
57 0.12
58 0.13
59 0.13
60 0.14
61 0.14
62 0.15
63 0.15
64 0.15
65 0.16
66 0.16
67 0.15
68 0.14
69 0.15
70 0.14
71 0.15
72 0.16
73 0.17
74 0.17
75 0.16
76 0.16
77 0.18
78 0.19
79 0.23
80 0.23
81 0.28
82 0.28
83 0.29
84 0.3
85 0.24
86 0.22
87 0.19
88 0.18
89 0.11
90 0.11
91 0.1
92 0.09
93 0.12
94 0.13
95 0.12
96 0.15
97 0.19
98 0.18
99 0.19
100 0.19
101 0.25
102 0.31
103 0.35
104 0.4
105 0.4
106 0.44
107 0.52
108 0.62
109 0.6
110 0.6
111 0.6
112 0.57
113 0.61
114 0.59
115 0.6
116 0.55
117 0.52
118 0.49
119 0.47
120 0.45
121 0.39
122 0.38
123 0.28
124 0.22
125 0.17
126 0.14
127 0.1
128 0.08
129 0.07
130 0.06
131 0.11
132 0.15
133 0.17
134 0.17
135 0.21
136 0.21
137 0.22
138 0.23
139 0.18
140 0.17
141 0.16
142 0.18
143 0.16
144 0.17
145 0.18
146 0.18
147 0.18
148 0.15
149 0.13
150 0.12
151 0.14
152 0.14
153 0.14
154 0.14
155 0.15
156 0.16
157 0.16
158 0.18
159 0.14
160 0.15
161 0.17
162 0.15
163 0.13
164 0.13
165 0.12
166 0.09
167 0.09
168 0.07
169 0.04
170 0.05
171 0.06
172 0.06
173 0.06
174 0.08
175 0.11
176 0.13
177 0.15
178 0.15
179 0.15
180 0.15
181 0.19
182 0.19
183 0.16
184 0.14
185 0.12
186 0.11
187 0.1
188 0.11
189 0.07
190 0.05
191 0.06
192 0.06
193 0.07
194 0.08
195 0.11
196 0.1
197 0.11
198 0.13
199 0.17
200 0.17
201 0.17
202 0.19
203 0.19
204 0.2
205 0.19
206 0.19
207 0.17
208 0.17
209 0.17
210 0.15
211 0.18
212 0.17
213 0.18
214 0.24
215 0.24
216 0.29
217 0.36
218 0.46
219 0.52
220 0.61
221 0.72
222 0.74
223 0.8
224 0.82
225 0.8
226 0.81
227 0.78
228 0.71
229 0.63
230 0.57
231 0.51
232 0.45
233 0.38
234 0.33
235 0.29
236 0.29
237 0.29
238 0.26
239 0.29
240 0.36
241 0.44
242 0.48
243 0.51
244 0.54
245 0.53
246 0.52
247 0.49
248 0.42
249 0.35