Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q3EMH4

Protein Details
Accession A0A1Q3EMH4    Localization Confidence High Confidence Score 21.3
NoLS Segment(s)
PositionSequenceProtein Nature
39-62STSAPTKRGRGRPKGSKNKKGASSHydrophilic
70-115TSDATPKKRGRPPKPKNPDESEGERAPKRKRGRPPKPKPEPAEAAEBasic
117-136TEDEPATKRKRGRPPKKSSTBasic
NLS Segment(s)
PositionSequence
44-61TKRGRGRPKGSKNKKGAS
74-135TPKKRGRPPKPKNPDESEGERAPKRKRGRPPKPKPEPAEAAEGTEDEPATKRKRGRPPKKSS
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MSSPPDPLENANRPVDDDDELDDPQEGEHDDGNNAAGGSTSAPTKRGRGRPKGSKNKKGASSSTTAGPSTSDATPKKRGRPPKPKNPDESEGERAPKRKRGRPPKPKPEPAEAAEGTEDEPATKRKRGRPPKKSST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.28
4 0.22
5 0.2
6 0.19
7 0.19
8 0.17
9 0.15
10 0.13
11 0.11
12 0.11
13 0.09
14 0.07
15 0.09
16 0.09
17 0.09
18 0.09
19 0.1
20 0.09
21 0.08
22 0.07
23 0.05
24 0.05
25 0.05
26 0.06
27 0.07
28 0.07
29 0.1
30 0.11
31 0.17
32 0.25
33 0.33
34 0.42
35 0.5
36 0.59
37 0.68
38 0.78
39 0.84
40 0.86
41 0.86
42 0.85
43 0.82
44 0.78
45 0.72
46 0.63
47 0.55
48 0.49
49 0.4
50 0.35
51 0.29
52 0.23
53 0.19
54 0.16
55 0.13
56 0.12
57 0.11
58 0.14
59 0.15
60 0.19
61 0.29
62 0.32
63 0.4
64 0.44
65 0.54
66 0.61
67 0.7
68 0.76
69 0.78
70 0.84
71 0.83
72 0.84
73 0.81
74 0.74
75 0.69
76 0.65
77 0.6
78 0.52
79 0.5
80 0.46
81 0.45
82 0.45
83 0.47
84 0.49
85 0.52
86 0.6
87 0.66
88 0.74
89 0.8
90 0.87
91 0.9
92 0.92
93 0.94
94 0.88
95 0.85
96 0.8
97 0.72
98 0.68
99 0.57
100 0.48
101 0.39
102 0.33
103 0.25
104 0.2
105 0.17
106 0.1
107 0.12
108 0.17
109 0.21
110 0.27
111 0.34
112 0.43
113 0.54
114 0.65
115 0.74
116 0.79