Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q3EM87

Protein Details
Accession A0A1Q3EM87    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
44-69WWECSIRQRRRWKCSWTWKRNIHYPFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.166, nucl 11.5, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MTDCYFRHPNLGKHPPHQRPCQCIVVNNQNVQWMTKERVGRGWWWECSIRQRRRWKCSWTWKRNIHYPFQVVFDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.72
3 0.74
4 0.77
5 0.74
6 0.71
7 0.71
8 0.71
9 0.62
10 0.56
11 0.56
12 0.56
13 0.53
14 0.47
15 0.42
16 0.37
17 0.36
18 0.32
19 0.26
20 0.19
21 0.18
22 0.2
23 0.21
24 0.19
25 0.22
26 0.23
27 0.23
28 0.26
29 0.27
30 0.24
31 0.25
32 0.27
33 0.25
34 0.34
35 0.43
36 0.45
37 0.5
38 0.6
39 0.67
40 0.74
41 0.8
42 0.78
43 0.78
44 0.81
45 0.84
46 0.83
47 0.84
48 0.85
49 0.84
50 0.85
51 0.8
52 0.77
53 0.73
54 0.68
55 0.6