Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4EZB5

Protein Details
Accession A0A0C4EZB5    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
46-67QECGCRVMYKKRIKRMVQFEARHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto_nucl 8, nucl 7.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006591  RNAP_P/RPABC4  
IPR039747  RPABC4  
IPR029040  RPABC4/Spt4  
Gene Ontology GO:0005736  C:RNA polymerase I complex  
GO:0005665  C:RNA polymerase II, core complex  
GO:0005666  C:RNA polymerase III complex  
GO:0003677  F:DNA binding  
GO:0001054  F:RNA polymerase I activity  
GO:0001055  F:RNA polymerase II activity  
GO:0001056  F:RNA polymerase III activity  
GO:0003968  F:RNA-dependent RNA polymerase activity  
GO:0008270  F:zinc ion binding  
GO:0006363  P:termination of RNA polymerase I transcription  
GO:0006386  P:termination of RNA polymerase III transcription  
GO:0006362  P:transcription elongation by RNA polymerase I  
GO:0006368  P:transcription elongation by RNA polymerase II  
GO:0006361  P:transcription initiation at RNA polymerase I promoter  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
GO:0006384  P:transcription initiation at RNA polymerase III promoter  
GO:0042797  P:tRNA transcription by RNA polymerase III  
Pfam View protein in Pfam  
PF03604  DNA_RNApol_7kD  
Amino Acid Sequences MSQPYVQIANAQPGFGRTAAPAPITYLCADCGKDNSIKPREPIRCQECGCRVMYKKRIKRMVQFEAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.18
3 0.17
4 0.09
5 0.11
6 0.12
7 0.13
8 0.12
9 0.12
10 0.13
11 0.13
12 0.13
13 0.11
14 0.11
15 0.12
16 0.12
17 0.11
18 0.12
19 0.12
20 0.14
21 0.16
22 0.23
23 0.26
24 0.27
25 0.3
26 0.37
27 0.42
28 0.44
29 0.52
30 0.49
31 0.52
32 0.52
33 0.57
34 0.53
35 0.49
36 0.46
37 0.44
38 0.45
39 0.47
40 0.55
41 0.59
42 0.62
43 0.69
44 0.77
45 0.77
46 0.81
47 0.81