Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q3DY78

Protein Details
Accession A0A1Q3DY78   
Localization Confidence High
Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
177-197AKTGRRKSTTKKAATTRVRASHydrophilic
NLS Segment(s)
PositionSequence
107-119KLSRSRKKNAKSK
180-211GRRKSTTKKAATTRVRASTTGSSTRPAKKRKR
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR012423  Eaf7/MRGBP  
Gene Ontology GO:0043189  C:H4/H2A histone acetyltransferase complex  
GO:0005634  C:nucleus  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF07904  Eaf7  
Amino Acid Sequences MRSSIHKDTGHWVPVDELWQKLRSCYNIDALDAIELEYEIALSNKISLQSPSIDGQNIKHPYIRGEFSLPSEPSLDPLISTRRVNPIASPPSSPETAATSPAALKVKLSRSRKKNAKSKASMAGLVGGESDSSDLTDSGEEGQAPSVVTATDGGETVDGEADDDIEIRDATPDTAAAKTGRRKSTTKKAATTRVRASTTGSSTRPAKKRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.28
4 0.24
5 0.23
6 0.28
7 0.27
8 0.28
9 0.32
10 0.3
11 0.33
12 0.33
13 0.36
14 0.32
15 0.33
16 0.3
17 0.26
18 0.23
19 0.18
20 0.15
21 0.08
22 0.06
23 0.06
24 0.05
25 0.04
26 0.04
27 0.04
28 0.05
29 0.04
30 0.05
31 0.07
32 0.08
33 0.09
34 0.1
35 0.11
36 0.13
37 0.15
38 0.16
39 0.16
40 0.17
41 0.17
42 0.18
43 0.25
44 0.26
45 0.25
46 0.26
47 0.25
48 0.26
49 0.29
50 0.29
51 0.22
52 0.22
53 0.22
54 0.23
55 0.28
56 0.25
57 0.22
58 0.22
59 0.2
60 0.19
61 0.19
62 0.16
63 0.1
64 0.12
65 0.15
66 0.15
67 0.16
68 0.17
69 0.2
70 0.22
71 0.22
72 0.22
73 0.27
74 0.29
75 0.29
76 0.28
77 0.25
78 0.26
79 0.26
80 0.25
81 0.17
82 0.16
83 0.16
84 0.16
85 0.14
86 0.12
87 0.11
88 0.14
89 0.14
90 0.1
91 0.1
92 0.12
93 0.19
94 0.27
95 0.34
96 0.4
97 0.45
98 0.56
99 0.64
100 0.69
101 0.71
102 0.73
103 0.75
104 0.72
105 0.7
106 0.67
107 0.6
108 0.52
109 0.43
110 0.36
111 0.26
112 0.2
113 0.16
114 0.08
115 0.06
116 0.06
117 0.06
118 0.03
119 0.03
120 0.04
121 0.04
122 0.04
123 0.04
124 0.05
125 0.05
126 0.06
127 0.06
128 0.06
129 0.06
130 0.06
131 0.06
132 0.06
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.05
143 0.05
144 0.05
145 0.05
146 0.05
147 0.04
148 0.05
149 0.05
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.06
156 0.06
157 0.07
158 0.07
159 0.08
160 0.09
161 0.09
162 0.11
163 0.12
164 0.18
165 0.26
166 0.34
167 0.4
168 0.43
169 0.49
170 0.57
171 0.66
172 0.7
173 0.7
174 0.71
175 0.73
176 0.78
177 0.81
178 0.81
179 0.78
180 0.75
181 0.69
182 0.61
183 0.58
184 0.54
185 0.51
186 0.48
187 0.42
188 0.4
189 0.44
190 0.53
191 0.57