Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q3EG35

Protein Details
Accession A0A1Q3EG35   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
140-178KEEARAKEKEEKRRRKEEKRARKEERRVRKESRKESRSEBasic
NLS Segment(s)
PositionSequence
138-176IEKEEARAKEKEEKRRRKEEKRARKEERRVRKESRKESR
Subcellular Location(s) nucl 9.5, cyto_nucl 7, extr 4, cyto 3.5, mito 3, E.R. 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019315  MMTA2_N  
IPR039207  MMTAG2-like  
Pfam View protein in Pfam  
PF10159  MMtag  
Amino Acid Sequences MLCLFLSFPRARSDLSLSLHPSLPLSLHDTHPQNYLGHSINAPTGRWQKNKDVHWYSRDLKDSEAERLEEIRKIKEAEADALAVALGFTPEPRSSSKPDTGTGTMSSLPSSLPPSVSPGDGDKPTPRPEDPKDPQRIIEKEEARAKEKEEKRRRKEEKRARKEERRVRKESRKESRSESKEEAAVGVGVAPVLLVSVVAVPVPVDPIPLATPPAAAPISPQNEDVVNRGRGLDPERRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.34
3 0.37
4 0.36
5 0.37
6 0.37
7 0.34
8 0.28
9 0.22
10 0.2
11 0.16
12 0.18
13 0.17
14 0.19
15 0.26
16 0.29
17 0.3
18 0.32
19 0.32
20 0.28
21 0.26
22 0.28
23 0.23
24 0.21
25 0.2
26 0.18
27 0.2
28 0.21
29 0.2
30 0.23
31 0.3
32 0.36
33 0.41
34 0.45
35 0.5
36 0.57
37 0.62
38 0.65
39 0.64
40 0.63
41 0.62
42 0.64
43 0.59
44 0.58
45 0.57
46 0.47
47 0.4
48 0.4
49 0.37
50 0.35
51 0.32
52 0.26
53 0.23
54 0.25
55 0.25
56 0.23
57 0.23
58 0.2
59 0.2
60 0.21
61 0.21
62 0.22
63 0.22
64 0.2
65 0.19
66 0.18
67 0.15
68 0.13
69 0.12
70 0.07
71 0.06
72 0.03
73 0.03
74 0.02
75 0.03
76 0.05
77 0.05
78 0.08
79 0.11
80 0.14
81 0.19
82 0.25
83 0.3
84 0.29
85 0.31
86 0.33
87 0.31
88 0.29
89 0.25
90 0.21
91 0.17
92 0.15
93 0.13
94 0.09
95 0.08
96 0.07
97 0.09
98 0.08
99 0.08
100 0.08
101 0.11
102 0.12
103 0.12
104 0.11
105 0.11
106 0.13
107 0.13
108 0.15
109 0.14
110 0.17
111 0.2
112 0.22
113 0.21
114 0.25
115 0.29
116 0.38
117 0.42
118 0.48
119 0.51
120 0.5
121 0.52
122 0.53
123 0.5
124 0.44
125 0.45
126 0.38
127 0.36
128 0.41
129 0.41
130 0.37
131 0.37
132 0.36
133 0.37
134 0.43
135 0.49
136 0.54
137 0.62
138 0.67
139 0.77
140 0.84
141 0.85
142 0.89
143 0.9
144 0.9
145 0.9
146 0.93
147 0.92
148 0.92
149 0.92
150 0.91
151 0.91
152 0.88
153 0.86
154 0.85
155 0.86
156 0.86
157 0.86
158 0.86
159 0.81
160 0.76
161 0.76
162 0.77
163 0.71
164 0.68
165 0.61
166 0.53
167 0.48
168 0.44
169 0.36
170 0.26
171 0.21
172 0.14
173 0.09
174 0.07
175 0.05
176 0.04
177 0.03
178 0.03
179 0.02
180 0.02
181 0.02
182 0.02
183 0.03
184 0.03
185 0.03
186 0.03
187 0.03
188 0.04
189 0.06
190 0.06
191 0.06
192 0.06
193 0.08
194 0.1
195 0.11
196 0.12
197 0.1
198 0.11
199 0.11
200 0.15
201 0.13
202 0.12
203 0.14
204 0.2
205 0.25
206 0.26
207 0.26
208 0.24
209 0.26
210 0.28
211 0.3
212 0.29
213 0.26
214 0.25
215 0.26
216 0.26
217 0.27
218 0.32