Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q3E2F3

Protein Details
Accession A0A1Q3E2F3    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
30-49TKSACKRRTLQRILSQHRKRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR025959  Winged_HTH_dom  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF13592  HTH_33  
Amino Acid Sequences MTRGKPLSKDLRHTIINLRRNCVSLDEIVTKSACKRRTLQRILSQHRKRIQGTLLLTTDLRGRKRKISIEDMKLIHGLLANTPDMYLDELKQQLEERRGTQVSITTIWRTLRQTGYKLKKITRVAIEQDEFKRAQFKLTYSHLYQAAQLVFMTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.56
3 0.58
4 0.53
5 0.51
6 0.47
7 0.46
8 0.44
9 0.37
10 0.31
11 0.25
12 0.26
13 0.26
14 0.25
15 0.25
16 0.24
17 0.22
18 0.25
19 0.29
20 0.29
21 0.28
22 0.34
23 0.43
24 0.54
25 0.61
26 0.64
27 0.67
28 0.73
29 0.79
30 0.83
31 0.79
32 0.77
33 0.75
34 0.72
35 0.64
36 0.58
37 0.51
38 0.47
39 0.43
40 0.39
41 0.33
42 0.28
43 0.27
44 0.22
45 0.24
46 0.21
47 0.23
48 0.24
49 0.26
50 0.31
51 0.36
52 0.42
53 0.43
54 0.49
55 0.52
56 0.51
57 0.55
58 0.5
59 0.45
60 0.39
61 0.34
62 0.24
63 0.17
64 0.12
65 0.06
66 0.07
67 0.07
68 0.06
69 0.06
70 0.06
71 0.05
72 0.07
73 0.07
74 0.06
75 0.08
76 0.1
77 0.1
78 0.1
79 0.12
80 0.15
81 0.18
82 0.2
83 0.19
84 0.23
85 0.23
86 0.23
87 0.22
88 0.2
89 0.18
90 0.18
91 0.19
92 0.15
93 0.17
94 0.18
95 0.21
96 0.2
97 0.22
98 0.27
99 0.28
100 0.33
101 0.41
102 0.49
103 0.53
104 0.56
105 0.56
106 0.58
107 0.59
108 0.61
109 0.57
110 0.53
111 0.51
112 0.53
113 0.51
114 0.49
115 0.46
116 0.44
117 0.38
118 0.33
119 0.33
120 0.26
121 0.29
122 0.26
123 0.26
124 0.29
125 0.34
126 0.4
127 0.37
128 0.41
129 0.38
130 0.36
131 0.35
132 0.33
133 0.28
134 0.22