Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q3DZU0

Protein Details
Accession A0A1Q3DZU0   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
18-42ASTNGPVSKRRRKNDGEPSEPRRLRHydrophilic
45-68HEACTRCRGKKIKCDSKHPRYSSSHydrophilic
NLS Segment(s)
PositionSequence
26-43KRRRKNDGEPSEPRRLRR
Subcellular Location(s) nucl 10.5, cyto_nucl 9.5, cyto 7.5, plas 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
CDD cd12148  fungal_TF_MHR  
cd00067  GAL4  
Amino Acid Sequences MDDHGGTLMMESMDGSGASTNGPVSKRRRKNDGEPSEPRRLRRSHEACTRCRGKKIKCDSKHPRYSSSSQPAPAMNPAPPPPPPGYFAHPPPPGVGYYQYPPYMYPAPPPFQLSPLSASPAPLYHYHPPAVVYNSSITPLPSSSTATARLAEEDLAVGSSGLDSGRDRVVQLEMPAPRDTAKWRVVSVFRSQHFSSTPSMDIWIPNDRNTLLEIVDVYFTQLNPHRPVFFRHQFLESLNQLYDEGASSRPVFDPGFICSLYLVLALGTLSELNRSGYQGEAPVGDSAADHDSKICYNYFRDRRFTPPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.06
5 0.06
6 0.07
7 0.07
8 0.11
9 0.13
10 0.2
11 0.29
12 0.4
13 0.5
14 0.57
15 0.66
16 0.7
17 0.79
18 0.83
19 0.84
20 0.82
21 0.82
22 0.82
23 0.84
24 0.79
25 0.73
26 0.69
27 0.63
28 0.6
29 0.62
30 0.61
31 0.6
32 0.67
33 0.71
34 0.67
35 0.74
36 0.76
37 0.69
38 0.72
39 0.71
40 0.69
41 0.72
42 0.78
43 0.79
44 0.77
45 0.83
46 0.85
47 0.87
48 0.88
49 0.82
50 0.78
51 0.74
52 0.72
53 0.7
54 0.68
55 0.62
56 0.53
57 0.52
58 0.46
59 0.4
60 0.39
61 0.31
62 0.24
63 0.23
64 0.24
65 0.24
66 0.23
67 0.26
68 0.25
69 0.25
70 0.27
71 0.26
72 0.3
73 0.32
74 0.36
75 0.4
76 0.38
77 0.37
78 0.35
79 0.33
80 0.27
81 0.24
82 0.22
83 0.16
84 0.17
85 0.19
86 0.19
87 0.18
88 0.17
89 0.2
90 0.21
91 0.19
92 0.23
93 0.25
94 0.27
95 0.27
96 0.31
97 0.28
98 0.26
99 0.28
100 0.22
101 0.21
102 0.19
103 0.21
104 0.17
105 0.17
106 0.15
107 0.14
108 0.15
109 0.13
110 0.17
111 0.18
112 0.2
113 0.21
114 0.2
115 0.21
116 0.21
117 0.22
118 0.17
119 0.14
120 0.13
121 0.13
122 0.13
123 0.12
124 0.1
125 0.08
126 0.08
127 0.08
128 0.08
129 0.09
130 0.1
131 0.11
132 0.13
133 0.13
134 0.13
135 0.12
136 0.12
137 0.11
138 0.1
139 0.08
140 0.06
141 0.05
142 0.04
143 0.04
144 0.03
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.03
151 0.05
152 0.06
153 0.06
154 0.06
155 0.07
156 0.09
157 0.09
158 0.1
159 0.13
160 0.13
161 0.16
162 0.16
163 0.16
164 0.15
165 0.16
166 0.17
167 0.19
168 0.22
169 0.21
170 0.22
171 0.25
172 0.27
173 0.28
174 0.33
175 0.34
176 0.3
177 0.35
178 0.34
179 0.33
180 0.31
181 0.31
182 0.26
183 0.21
184 0.21
185 0.16
186 0.17
187 0.15
188 0.15
189 0.15
190 0.21
191 0.19
192 0.19
193 0.21
194 0.19
195 0.19
196 0.2
197 0.18
198 0.1
199 0.1
200 0.09
201 0.08
202 0.08
203 0.08
204 0.08
205 0.08
206 0.07
207 0.11
208 0.15
209 0.19
210 0.23
211 0.25
212 0.27
213 0.28
214 0.33
215 0.39
216 0.42
217 0.42
218 0.4
219 0.41
220 0.39
221 0.39
222 0.41
223 0.33
224 0.28
225 0.23
226 0.21
227 0.19
228 0.18
229 0.16
230 0.1
231 0.1
232 0.08
233 0.1
234 0.1
235 0.11
236 0.12
237 0.14
238 0.13
239 0.14
240 0.15
241 0.16
242 0.18
243 0.17
244 0.16
245 0.14
246 0.13
247 0.12
248 0.1
249 0.07
250 0.04
251 0.04
252 0.04
253 0.04
254 0.04
255 0.05
256 0.05
257 0.06
258 0.07
259 0.09
260 0.1
261 0.11
262 0.12
263 0.12
264 0.14
265 0.14
266 0.15
267 0.13
268 0.13
269 0.13
270 0.12
271 0.11
272 0.1
273 0.1
274 0.13
275 0.13
276 0.11
277 0.12
278 0.14
279 0.16
280 0.18
281 0.18
282 0.17
283 0.23
284 0.34
285 0.42
286 0.47
287 0.52
288 0.54