Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q3E1V4

Protein Details
Accession A0A1Q3E1V4    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGTDKRKRQRSARNTVEHEQIHydrophilic
142-166VTKAIQSIKRNRKNRHGKLRDMTREHydrophilic
NLS Segment(s)
PositionSequence
151-157RNRKNRH
Subcellular Location(s) nucl 19, cyto_nucl 12.5, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR031824  RNF220_mid  
Pfam View protein in Pfam  
PF15926  RNF220  
Amino Acid Sequences MGTDKRKRQRSARNTVEHEQIAETSEAGSSNISPAPEAPVAKRSRHRAETRDCPICNEPIPLRLLGKHAELEASRVDEIIGHIGSEEPFLDLSYESYTSAPAVTSTSGLSFTSVSHGRRSAVRARRTILEKTAPVRAQSTVVTKAIQSIKRNRKNRHGKLRDMTREDDEGHLASHLRYTSSRGGIVCPVCLATVEGDEDVQNAHVEACVANESVRLEEERLRREEQERREEDEKVDTDDENEQDDAAGHFGDVRGTGFLTRNRNEQDVEDEIDIDGDDAEIFGSAQFHEGDILDVDVPPTTAARTQPTSGRFQTGGVDDTFSEGDQPAKILRDLIADKQRNPSCASGRIRKQNQASGGPTRKFTISFVLYPTLPDLYRALQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.82
3 0.79
4 0.69
5 0.59
6 0.5
7 0.39
8 0.32
9 0.25
10 0.2
11 0.13
12 0.12
13 0.11
14 0.1
15 0.1
16 0.08
17 0.1
18 0.11
19 0.11
20 0.11
21 0.11
22 0.16
23 0.19
24 0.2
25 0.2
26 0.27
27 0.31
28 0.38
29 0.45
30 0.49
31 0.55
32 0.63
33 0.69
34 0.69
35 0.75
36 0.78
37 0.79
38 0.79
39 0.7
40 0.66
41 0.61
42 0.56
43 0.49
44 0.44
45 0.37
46 0.32
47 0.34
48 0.3
49 0.29
50 0.26
51 0.27
52 0.23
53 0.24
54 0.21
55 0.19
56 0.2
57 0.18
58 0.19
59 0.17
60 0.17
61 0.15
62 0.14
63 0.13
64 0.11
65 0.11
66 0.12
67 0.1
68 0.08
69 0.08
70 0.09
71 0.09
72 0.09
73 0.08
74 0.06
75 0.06
76 0.06
77 0.07
78 0.06
79 0.07
80 0.09
81 0.09
82 0.09
83 0.1
84 0.1
85 0.09
86 0.09
87 0.08
88 0.06
89 0.07
90 0.07
91 0.07
92 0.07
93 0.08
94 0.08
95 0.08
96 0.09
97 0.08
98 0.08
99 0.12
100 0.15
101 0.16
102 0.18
103 0.19
104 0.2
105 0.22
106 0.27
107 0.32
108 0.37
109 0.42
110 0.43
111 0.45
112 0.49
113 0.51
114 0.49
115 0.45
116 0.41
117 0.37
118 0.36
119 0.4
120 0.35
121 0.32
122 0.3
123 0.26
124 0.23
125 0.21
126 0.23
127 0.18
128 0.18
129 0.18
130 0.16
131 0.2
132 0.25
133 0.27
134 0.3
135 0.38
136 0.48
137 0.57
138 0.66
139 0.67
140 0.72
141 0.79
142 0.83
143 0.84
144 0.81
145 0.8
146 0.79
147 0.83
148 0.8
149 0.72
150 0.65
151 0.56
152 0.5
153 0.43
154 0.35
155 0.26
156 0.19
157 0.14
158 0.12
159 0.1
160 0.08
161 0.08
162 0.07
163 0.07
164 0.08
165 0.11
166 0.14
167 0.15
168 0.17
169 0.15
170 0.16
171 0.19
172 0.19
173 0.15
174 0.12
175 0.11
176 0.09
177 0.09
178 0.08
179 0.05
180 0.05
181 0.05
182 0.05
183 0.05
184 0.05
185 0.05
186 0.05
187 0.05
188 0.04
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.04
195 0.05
196 0.05
197 0.05
198 0.06
199 0.06
200 0.06
201 0.07
202 0.07
203 0.08
204 0.13
205 0.18
206 0.21
207 0.24
208 0.26
209 0.28
210 0.33
211 0.4
212 0.41
213 0.47
214 0.46
215 0.49
216 0.5
217 0.48
218 0.44
219 0.42
220 0.35
221 0.28
222 0.26
223 0.2
224 0.19
225 0.2
226 0.19
227 0.15
228 0.15
229 0.11
230 0.1
231 0.1
232 0.09
233 0.07
234 0.06
235 0.04
236 0.05
237 0.05
238 0.05
239 0.05
240 0.05
241 0.05
242 0.05
243 0.07
244 0.1
245 0.15
246 0.22
247 0.24
248 0.29
249 0.31
250 0.33
251 0.33
252 0.3
253 0.3
254 0.26
255 0.27
256 0.21
257 0.19
258 0.17
259 0.16
260 0.14
261 0.09
262 0.06
263 0.04
264 0.04
265 0.03
266 0.03
267 0.03
268 0.03
269 0.03
270 0.04
271 0.04
272 0.06
273 0.06
274 0.06
275 0.07
276 0.07
277 0.07
278 0.07
279 0.08
280 0.07
281 0.07
282 0.07
283 0.06
284 0.06
285 0.06
286 0.06
287 0.06
288 0.08
289 0.11
290 0.15
291 0.18
292 0.21
293 0.26
294 0.29
295 0.35
296 0.35
297 0.37
298 0.32
299 0.3
300 0.32
301 0.28
302 0.27
303 0.21
304 0.2
305 0.15
306 0.17
307 0.17
308 0.13
309 0.12
310 0.1
311 0.11
312 0.1
313 0.11
314 0.11
315 0.13
316 0.13
317 0.13
318 0.14
319 0.19
320 0.21
321 0.28
322 0.37
323 0.39
324 0.41
325 0.5
326 0.53
327 0.49
328 0.5
329 0.49
330 0.43
331 0.48
332 0.54
333 0.54
334 0.6
335 0.68
336 0.72
337 0.74
338 0.75
339 0.73
340 0.71
341 0.68
342 0.65
343 0.64
344 0.67
345 0.61
346 0.56
347 0.52
348 0.47
349 0.41
350 0.37
351 0.35
352 0.31
353 0.31
354 0.32
355 0.33
356 0.31
357 0.31
358 0.32
359 0.26
360 0.21
361 0.21