Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q3E2H1

Protein Details
Accession A0A1Q3E2H1    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
131-158EKLVKKYERGKWRKFMQQKLRNPKPYSYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto 8.5, cyto_nucl 7, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035892  C2_domain_sf  
IPR002420  PI3K-type_C2_dom  
Gene Ontology GO:0016301  F:kinase activity  
GO:0016310  P:phosphorylation  
Pfam View protein in Pfam  
PF00792  PI3K_C2  
PROSITE View protein in PROSITE  
PS51547  C2_PI3K  
CDD cd08397  C2_PI3K_class_III  
Amino Acid Sequences MFNDRGGSRTLSDLYVICQLIADNKPLTIPFRTVFQAFKNAYIWNEWITFPIRYCDLPLSSQITFTVWDIAGPRSAAPVGGTTFRLFGKKWTLRRGKHRLLLWPGIEADGCVDSATPSKIPGATDEMGRLEKLVKKYERGKWRKFMQQKLRNPKPYSYTSTSRDLTFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.19
4 0.15
5 0.14
6 0.14
7 0.18
8 0.19
9 0.2
10 0.15
11 0.15
12 0.17
13 0.17
14 0.2
15 0.17
16 0.19
17 0.16
18 0.19
19 0.22
20 0.22
21 0.24
22 0.23
23 0.29
24 0.27
25 0.28
26 0.26
27 0.25
28 0.24
29 0.24
30 0.23
31 0.17
32 0.18
33 0.15
34 0.16
35 0.17
36 0.17
37 0.15
38 0.16
39 0.15
40 0.14
41 0.16
42 0.17
43 0.15
44 0.16
45 0.17
46 0.19
47 0.17
48 0.18
49 0.16
50 0.14
51 0.13
52 0.12
53 0.12
54 0.08
55 0.08
56 0.09
57 0.09
58 0.1
59 0.09
60 0.09
61 0.07
62 0.07
63 0.07
64 0.06
65 0.06
66 0.06
67 0.07
68 0.08
69 0.08
70 0.09
71 0.1
72 0.11
73 0.1
74 0.11
75 0.2
76 0.25
77 0.29
78 0.38
79 0.47
80 0.51
81 0.62
82 0.69
83 0.66
84 0.66
85 0.65
86 0.62
87 0.59
88 0.58
89 0.48
90 0.4
91 0.33
92 0.27
93 0.24
94 0.16
95 0.11
96 0.07
97 0.06
98 0.05
99 0.05
100 0.05
101 0.07
102 0.08
103 0.07
104 0.08
105 0.09
106 0.1
107 0.1
108 0.12
109 0.16
110 0.15
111 0.16
112 0.17
113 0.18
114 0.18
115 0.17
116 0.15
117 0.14
118 0.18
119 0.21
120 0.28
121 0.29
122 0.36
123 0.44
124 0.53
125 0.61
126 0.66
127 0.7
128 0.71
129 0.76
130 0.8
131 0.8
132 0.82
133 0.83
134 0.83
135 0.85
136 0.87
137 0.9
138 0.89
139 0.84
140 0.8
141 0.75
142 0.72
143 0.7
144 0.65
145 0.62
146 0.57
147 0.6
148 0.55