Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q3ERW6

Protein Details
Accession A0A1Q3ERW6    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
33-53TALKALKRRDRTKKWDPRVLDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 10.5, cyto_mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
Gene Ontology GO:0016787  F:hydrolase activity  
Amino Acid Sequences MLSPAGSHHLNKLRSILIKGAYERRDVWPDRVTALKALKRRDRTKKWDPRVLDIFIKHGIRPYPGSYYPRILIWE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.31
4 0.27
5 0.28
6 0.3
7 0.35
8 0.32
9 0.32
10 0.31
11 0.32
12 0.35
13 0.34
14 0.35
15 0.31
16 0.3
17 0.29
18 0.29
19 0.25
20 0.22
21 0.25
22 0.25
23 0.26
24 0.32
25 0.37
26 0.43
27 0.52
28 0.59
29 0.63
30 0.68
31 0.75
32 0.79
33 0.81
34 0.81
35 0.75
36 0.72
37 0.68
38 0.63
39 0.56
40 0.46
41 0.4
42 0.37
43 0.35
44 0.28
45 0.27
46 0.25
47 0.23
48 0.26
49 0.26
50 0.28
51 0.32
52 0.36
53 0.37
54 0.4
55 0.38