Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q3E545

Protein Details
Accession A0A1Q3E545    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
9-36PTSSGGKAAKKKKWSKGKVKDKAQHAVAHydrophilic
NLS Segment(s)
PositionSequence
12-30SGGKAAKKKKWSKGKVKDK
Subcellular Location(s) mito 12, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAAAPTSSGGKAAKKKKWSKGKVKDKAQHAVAVDKVLFDRIVKEVPTFRMISVSTLIDRLKVNGSLARRAIQHLEKEGHIKRIVHHSRQLIYTRATAAAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.34
3 0.41
4 0.46
5 0.53
6 0.61
7 0.69
8 0.78
9 0.82
10 0.84
11 0.86
12 0.9
13 0.9
14 0.91
15 0.88
16 0.84
17 0.8
18 0.71
19 0.63
20 0.53
21 0.46
22 0.36
23 0.3
24 0.23
25 0.16
26 0.14
27 0.11
28 0.1
29 0.07
30 0.08
31 0.08
32 0.09
33 0.09
34 0.11
35 0.12
36 0.14
37 0.16
38 0.15
39 0.14
40 0.14
41 0.14
42 0.14
43 0.13
44 0.12
45 0.1
46 0.11
47 0.11
48 0.11
49 0.11
50 0.11
51 0.11
52 0.11
53 0.12
54 0.13
55 0.16
56 0.18
57 0.19
58 0.2
59 0.2
60 0.21
61 0.25
62 0.26
63 0.27
64 0.28
65 0.29
66 0.28
67 0.35
68 0.36
69 0.36
70 0.36
71 0.34
72 0.32
73 0.41
74 0.47
75 0.46
76 0.51
77 0.5
78 0.5
79 0.55
80 0.55
81 0.48
82 0.43
83 0.39
84 0.34