Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q3ER75

Protein Details
Accession A0A1Q3ER75   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
93-114VLRRHQLICKGKKRFPPPGQPGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10, cyto_nucl 9.5, nucl 7, pero 6, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MWTLAQDTPTFDVDDDVFDGSEAVSPKKQVASDALVTAATGRRKNEAAFHCEFPGCEATFTAKHNLHNHLNSHFGIKSFRCPRCLRDFGTPHVLRRHQLICKGKKRFPPPGQPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.12
4 0.1
5 0.09
6 0.09
7 0.07
8 0.1
9 0.1
10 0.11
11 0.11
12 0.12
13 0.14
14 0.16
15 0.16
16 0.15
17 0.17
18 0.2
19 0.2
20 0.2
21 0.19
22 0.16
23 0.15
24 0.15
25 0.15
26 0.14
27 0.15
28 0.15
29 0.17
30 0.19
31 0.2
32 0.26
33 0.26
34 0.29
35 0.3
36 0.31
37 0.3
38 0.29
39 0.28
40 0.22
41 0.21
42 0.14
43 0.11
44 0.1
45 0.11
46 0.12
47 0.14
48 0.17
49 0.17
50 0.21
51 0.24
52 0.29
53 0.31
54 0.33
55 0.34
56 0.3
57 0.31
58 0.28
59 0.27
60 0.22
61 0.19
62 0.19
63 0.18
64 0.26
65 0.32
66 0.35
67 0.39
68 0.4
69 0.46
70 0.52
71 0.56
72 0.5
73 0.51
74 0.52
75 0.51
76 0.59
77 0.55
78 0.5
79 0.54
80 0.52
81 0.43
82 0.46
83 0.47
84 0.42
85 0.49
86 0.55
87 0.57
88 0.64
89 0.72
90 0.73
91 0.76
92 0.79
93 0.81
94 0.8