Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q3EMF3

Protein Details
Accession A0A1Q3EMF3    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
103-136NQNALIRRRHRNLMKRSWTKGKGHDKMKRRDFHFBasic
NLS Segment(s)
PositionSequence
109-132RRRHRNLMKRSWTKGKGHDKMKRR
Subcellular Location(s) nucl 10, mito 5, cyto 3, pero 3, cyto_pero 3, plas 2, extr 2
Family & Domain DBs
Amino Acid Sequences MESGHAIAALTPSGCLLRRREFFGSFRLPFRDRDIRNHIGGGRIDRKKTDGTSRRRDGAAWSSSTDWQTFRRISWPTEPANGWIHIDFTSDRQFIRAYEKVENQNALIRRRHRNLMKRSWTKGKGHDKMKRRDFHF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.15
3 0.2
4 0.28
5 0.31
6 0.37
7 0.41
8 0.44
9 0.43
10 0.47
11 0.49
12 0.43
13 0.44
14 0.44
15 0.41
16 0.39
17 0.44
18 0.46
19 0.4
20 0.46
21 0.51
22 0.5
23 0.49
24 0.5
25 0.43
26 0.37
27 0.36
28 0.34
29 0.35
30 0.34
31 0.34
32 0.33
33 0.34
34 0.33
35 0.35
36 0.39
37 0.39
38 0.44
39 0.53
40 0.56
41 0.56
42 0.54
43 0.51
44 0.44
45 0.42
46 0.35
47 0.27
48 0.24
49 0.23
50 0.24
51 0.24
52 0.21
53 0.15
54 0.14
55 0.17
56 0.16
57 0.15
58 0.19
59 0.2
60 0.22
61 0.26
62 0.29
63 0.26
64 0.29
65 0.28
66 0.26
67 0.27
68 0.25
69 0.21
70 0.16
71 0.15
72 0.12
73 0.14
74 0.11
75 0.11
76 0.15
77 0.15
78 0.15
79 0.15
80 0.16
81 0.15
82 0.22
83 0.23
84 0.22
85 0.26
86 0.32
87 0.37
88 0.39
89 0.39
90 0.33
91 0.35
92 0.36
93 0.36
94 0.38
95 0.39
96 0.46
97 0.5
98 0.59
99 0.63
100 0.68
101 0.72
102 0.76
103 0.8
104 0.8
105 0.82
106 0.83
107 0.81
108 0.78
109 0.78
110 0.78
111 0.76
112 0.78
113 0.79
114 0.79
115 0.82
116 0.86