Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4F0N5

Protein Details
Accession A0A0C4F0N5   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
133-159RSPQIRKLQPPQPTRRHRARIHQDLPPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019152  DUF2046  
Pfam View protein in Pfam  
PF09755  DUF2046  
Amino Acid Sequences MRRADSTRSNASSRSLRPAGDSKQQEDLINALEAEEERLVNTLTRKLEKLRAEKAELENVLEAESESLVLRLQRQLSLLITQQQQQQAAQPGSAAAPQTQPPPQLALRNHRPQPQCAHQQPPPPQSVPSHPDRSPQIRKLQPPQPTRRHRARIHQDLPPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.4
3 0.36
4 0.39
5 0.44
6 0.44
7 0.46
8 0.47
9 0.42
10 0.46
11 0.47
12 0.43
13 0.37
14 0.32
15 0.25
16 0.21
17 0.18
18 0.11
19 0.1
20 0.09
21 0.1
22 0.09
23 0.07
24 0.06
25 0.08
26 0.08
27 0.09
28 0.11
29 0.14
30 0.17
31 0.19
32 0.21
33 0.24
34 0.31
35 0.37
36 0.42
37 0.44
38 0.45
39 0.46
40 0.49
41 0.47
42 0.45
43 0.38
44 0.32
45 0.25
46 0.21
47 0.18
48 0.13
49 0.1
50 0.06
51 0.05
52 0.04
53 0.04
54 0.04
55 0.04
56 0.05
57 0.06
58 0.08
59 0.09
60 0.09
61 0.1
62 0.1
63 0.11
64 0.12
65 0.12
66 0.13
67 0.14
68 0.15
69 0.17
70 0.18
71 0.18
72 0.16
73 0.18
74 0.2
75 0.19
76 0.17
77 0.14
78 0.12
79 0.12
80 0.13
81 0.11
82 0.06
83 0.07
84 0.09
85 0.11
86 0.13
87 0.13
88 0.13
89 0.16
90 0.17
91 0.23
92 0.26
93 0.32
94 0.4
95 0.48
96 0.52
97 0.56
98 0.57
99 0.54
100 0.59
101 0.58
102 0.59
103 0.56
104 0.58
105 0.55
106 0.61
107 0.65
108 0.63
109 0.59
110 0.51
111 0.47
112 0.44
113 0.47
114 0.43
115 0.42
116 0.43
117 0.39
118 0.44
119 0.49
120 0.55
121 0.56
122 0.58
123 0.6
124 0.61
125 0.69
126 0.72
127 0.72
128 0.72
129 0.73
130 0.77
131 0.77
132 0.8
133 0.81
134 0.83
135 0.86
136 0.84
137 0.85
138 0.85
139 0.86
140 0.81