Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q3EJA6

Protein Details
Accession A0A1Q3EJA6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
77-101IEVYVEKKRKRPGRFTLRANCHASAHydrophilic
NLS Segment(s)
PositionSequence
84-88KRKRP
Subcellular Location(s) nucl 9mito 9mito_nucl 9
Family & Domain DBs
Amino Acid Sequences MTVLWSTSGSPSSSMVAIASQQPRPNTQAYNNNTTNNPRMILHPIPRLFFPAHCVVDRSWGGSCSGERGKDIFFQRIEVYVEKKRKRPGRFTLRANCHASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.1
4 0.1
5 0.15
6 0.18
7 0.2
8 0.23
9 0.25
10 0.27
11 0.3
12 0.32
13 0.29
14 0.32
15 0.38
16 0.4
17 0.46
18 0.46
19 0.45
20 0.44
21 0.44
22 0.41
23 0.33
24 0.29
25 0.21
26 0.21
27 0.24
28 0.27
29 0.27
30 0.31
31 0.31
32 0.3
33 0.3
34 0.3
35 0.25
36 0.21
37 0.2
38 0.18
39 0.19
40 0.18
41 0.19
42 0.17
43 0.21
44 0.21
45 0.19
46 0.15
47 0.14
48 0.15
49 0.14
50 0.14
51 0.14
52 0.16
53 0.15
54 0.15
55 0.16
56 0.16
57 0.22
58 0.24
59 0.25
60 0.22
61 0.24
62 0.24
63 0.25
64 0.26
65 0.23
66 0.25
67 0.29
68 0.38
69 0.42
70 0.48
71 0.56
72 0.62
73 0.69
74 0.73
75 0.76
76 0.78
77 0.81
78 0.85
79 0.86
80 0.86
81 0.85