Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q3DZ51

Protein Details
Accession A0A1Q3DZ51    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
165-189AAWILNPRARHRRRQQRDESETSSPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 8extr 8, mito 4, cyto 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR006603  PQ-loop_rpt  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF04193  PQ-loop  
Amino Acid Sequences MPVNSVAENAFGTAGTICWTIQLIPQLWKTYREKDTTGLSDWMILAWSVSGAFLGTYSIVKNINIPLILQPQLFAALTMASWAQCQFYGRGRSRNMSLLLFLIAEIEAVPKIYQHKEVIGISSLFLMVDLLGGNVNSFEFSGNFDIVAAVTYSLVIVMDGSVLIAAWILNPRARHRRRQQRDESETSSPGPTFSANHNSSIMIETDTAAATIVSQSPVETATTTPLGGSSCLLEKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.08
5 0.08
6 0.09
7 0.09
8 0.11
9 0.17
10 0.17
11 0.22
12 0.26
13 0.31
14 0.32
15 0.38
16 0.41
17 0.44
18 0.48
19 0.47
20 0.46
21 0.44
22 0.49
23 0.46
24 0.44
25 0.37
26 0.31
27 0.27
28 0.25
29 0.21
30 0.14
31 0.11
32 0.07
33 0.05
34 0.05
35 0.04
36 0.04
37 0.04
38 0.03
39 0.03
40 0.03
41 0.04
42 0.04
43 0.05
44 0.05
45 0.07
46 0.08
47 0.08
48 0.1
49 0.11
50 0.12
51 0.12
52 0.12
53 0.13
54 0.16
55 0.17
56 0.15
57 0.14
58 0.13
59 0.14
60 0.13
61 0.1
62 0.07
63 0.05
64 0.05
65 0.05
66 0.05
67 0.04
68 0.05
69 0.05
70 0.05
71 0.06
72 0.07
73 0.09
74 0.15
75 0.23
76 0.26
77 0.32
78 0.34
79 0.36
80 0.37
81 0.4
82 0.35
83 0.27
84 0.24
85 0.19
86 0.16
87 0.14
88 0.11
89 0.07
90 0.05
91 0.04
92 0.04
93 0.04
94 0.03
95 0.04
96 0.04
97 0.04
98 0.07
99 0.09
100 0.11
101 0.11
102 0.12
103 0.14
104 0.14
105 0.14
106 0.13
107 0.12
108 0.09
109 0.09
110 0.08
111 0.05
112 0.05
113 0.04
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.04
126 0.04
127 0.06
128 0.08
129 0.07
130 0.07
131 0.07
132 0.07
133 0.07
134 0.07
135 0.05
136 0.04
137 0.03
138 0.04
139 0.03
140 0.03
141 0.03
142 0.03
143 0.02
144 0.02
145 0.02
146 0.02
147 0.02
148 0.02
149 0.02
150 0.02
151 0.02
152 0.02
153 0.03
154 0.05
155 0.06
156 0.08
157 0.11
158 0.18
159 0.29
160 0.34
161 0.44
162 0.53
163 0.64
164 0.72
165 0.81
166 0.85
167 0.85
168 0.89
169 0.86
170 0.81
171 0.73
172 0.65
173 0.56
174 0.47
175 0.36
176 0.28
177 0.21
178 0.17
179 0.14
180 0.17
181 0.25
182 0.24
183 0.26
184 0.27
185 0.26
186 0.26
187 0.26
188 0.21
189 0.13
190 0.12
191 0.11
192 0.11
193 0.1
194 0.09
195 0.08
196 0.07
197 0.06
198 0.07
199 0.07
200 0.08
201 0.08
202 0.08
203 0.08
204 0.09
205 0.1
206 0.1
207 0.09
208 0.12
209 0.13
210 0.13
211 0.13
212 0.13
213 0.13
214 0.13
215 0.13
216 0.11