Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q3EK33

Protein Details
Accession A0A1Q3EK33    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
158-183ETAPRLHTQSRRKKTRTERREVELMQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 10.833, mito_nucl 10.333, cyto 4.5, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR042771  GTF3C6-like  
IPR019481  TFIIIC_triple_barrel  
Gene Ontology GO:0006383  P:transcription by RNA polymerase III  
Pfam View protein in Pfam  
PF10419  TFIIIC_sub6  
Amino Acid Sequences MASSSAATFPSSPSLGLCPGYRHVEQFGPDEEYEDEVEDFYVTLDLGAVEPTLIPSSSTYRLIGLDTPTPFMQLSGTVLQGRHESLLGTELLFVEGKADAQDRSKRHLSFTSTTEQRIRFKEVQLRPKVPAGVDSAVIDRTLERKESEPATSTQKDHETAPRLHTQSRRKKTRTERREVELMQFRGHLDTFLDNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.19
4 0.19
5 0.18
6 0.22
7 0.27
8 0.27
9 0.26
10 0.27
11 0.28
12 0.29
13 0.29
14 0.28
15 0.27
16 0.25
17 0.26
18 0.23
19 0.22
20 0.2
21 0.18
22 0.15
23 0.1
24 0.11
25 0.09
26 0.08
27 0.06
28 0.06
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.05
39 0.05
40 0.05
41 0.05
42 0.07
43 0.11
44 0.13
45 0.15
46 0.15
47 0.15
48 0.15
49 0.16
50 0.16
51 0.14
52 0.16
53 0.15
54 0.17
55 0.16
56 0.17
57 0.15
58 0.14
59 0.12
60 0.08
61 0.1
62 0.09
63 0.1
64 0.1
65 0.1
66 0.11
67 0.11
68 0.11
69 0.09
70 0.08
71 0.07
72 0.06
73 0.08
74 0.07
75 0.06
76 0.06
77 0.05
78 0.06
79 0.06
80 0.05
81 0.04
82 0.04
83 0.04
84 0.05
85 0.05
86 0.05
87 0.09
88 0.15
89 0.16
90 0.21
91 0.27
92 0.27
93 0.29
94 0.32
95 0.34
96 0.32
97 0.33
98 0.35
99 0.31
100 0.33
101 0.35
102 0.34
103 0.33
104 0.33
105 0.37
106 0.32
107 0.35
108 0.42
109 0.45
110 0.52
111 0.55
112 0.55
113 0.5
114 0.5
115 0.48
116 0.38
117 0.33
118 0.27
119 0.21
120 0.18
121 0.17
122 0.15
123 0.14
124 0.14
125 0.11
126 0.08
127 0.1
128 0.11
129 0.11
130 0.12
131 0.14
132 0.18
133 0.2
134 0.22
135 0.22
136 0.23
137 0.3
138 0.31
139 0.3
140 0.3
141 0.32
142 0.31
143 0.31
144 0.36
145 0.34
146 0.34
147 0.38
148 0.42
149 0.42
150 0.46
151 0.52
152 0.55
153 0.6
154 0.68
155 0.74
156 0.7
157 0.77
158 0.83
159 0.86
160 0.86
161 0.85
162 0.82
163 0.78
164 0.83
165 0.75
166 0.73
167 0.71
168 0.62
169 0.53
170 0.47
171 0.41
172 0.35
173 0.33
174 0.24
175 0.16