Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4FC06

Protein Details
Accession A0A0C4FC06   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
92-146WEYQLPKKKVGRPKKVKGSKEAPKRKRGRPRKTAAKPTRTCRKKKAKIASDTESEBasic
NLS Segment(s)
PositionSequence
63-138KQPHKGRPKGALNKSKPTLERSTKRDPSAWEYQLPKKKVGRPKKVKGSKEAPKRKRGRPRKTAAKPTRTCRKKKAK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences KVVLPCPSASSPPSNEDLDQLFLREIYKRFQKLTTSEKPNYIKDFTRLLDQSHWLTPLKEPVKQPHKGRPKGALNKSKPTLERSTKRDPSAWEYQLPKKKVGRPKKVKGSKEAPKRKRGRPRKTAAKPTRTCRKKKAKIASDTESEVLDESDNDSEQFLDESATLPCDPVAIVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.3
4 0.29
5 0.27
6 0.24
7 0.21
8 0.18
9 0.16
10 0.17
11 0.18
12 0.18
13 0.21
14 0.29
15 0.32
16 0.34
17 0.37
18 0.41
19 0.43
20 0.51
21 0.54
22 0.54
23 0.53
24 0.59
25 0.59
26 0.59
27 0.57
28 0.52
29 0.45
30 0.39
31 0.41
32 0.34
33 0.36
34 0.32
35 0.3
36 0.29
37 0.29
38 0.28
39 0.25
40 0.26
41 0.2
42 0.2
43 0.19
44 0.26
45 0.25
46 0.26
47 0.28
48 0.35
49 0.43
50 0.49
51 0.52
52 0.53
53 0.62
54 0.63
55 0.63
56 0.63
57 0.65
58 0.68
59 0.73
60 0.73
61 0.67
62 0.69
63 0.67
64 0.62
65 0.54
66 0.49
67 0.48
68 0.46
69 0.48
70 0.48
71 0.55
72 0.56
73 0.56
74 0.53
75 0.48
76 0.45
77 0.46
78 0.41
79 0.36
80 0.35
81 0.41
82 0.46
83 0.45
84 0.44
85 0.42
86 0.47
87 0.53
88 0.6
89 0.63
90 0.66
91 0.74
92 0.8
93 0.84
94 0.81
95 0.79
96 0.78
97 0.76
98 0.76
99 0.78
100 0.75
101 0.76
102 0.8
103 0.82
104 0.84
105 0.85
106 0.85
107 0.85
108 0.87
109 0.88
110 0.9
111 0.91
112 0.9
113 0.9
114 0.87
115 0.85
116 0.86
117 0.84
118 0.81
119 0.81
120 0.82
121 0.82
122 0.85
123 0.87
124 0.85
125 0.86
126 0.86
127 0.8
128 0.73
129 0.66
130 0.56
131 0.45
132 0.36
133 0.26
134 0.19
135 0.14
136 0.1
137 0.09
138 0.1
139 0.1
140 0.1
141 0.1
142 0.09
143 0.09
144 0.1
145 0.08
146 0.07
147 0.07
148 0.08
149 0.09
150 0.11
151 0.11
152 0.1
153 0.1
154 0.09