Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q3E202

Protein Details
Accession A0A1Q3E202    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
257-276KKSEEKRKEREGKKFGKQVQBasic
292-311ERLKGLKRKRKDILDNPDGNBasic
NLS Segment(s)
PositionSequence
253-302KAGIKKSEEKRKEREGKKFGKQVQIEKLKDRERGKKEMEERLKGLKRKRK
Subcellular Location(s) nucl 11.5, cyto 10, mito_nucl 9, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008610  Ebp2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF05890  Ebp2  
Amino Acid Sequences MSSTKSKSDRKSALKNVAPALATNKRSQIKEAPSVVEKEEDEIDLETDESEGSEDDGGIDDEGIERLMKALGDDGLDEFEQAQLEAALGDPEDESEEEDGEDANTEEENSDQDEEVEEVENDGTEGGEEDDQFIQLEDVEAIVDDAVPFQKVEINNEIALARIRESLQLDPSIPWTETLAVSYPHTIDVDVNDDLNRELAFYKQALHSASHAHQIATKSYPNFPWTRPSDYFAEMVKSDVHMERIRQRLLDEKAGIKKSEEKRKEREGKKFGKQVQIEKLKDRERGKKEMEERLKGLKRKRKDILDNPDGNDDAFDVAVEDAISDRPAKRGRGGPADQEKDPVVEAGVEEVQEVGEEVEEEAEAVGEEVGEVPKGLASQNVWTHVASDTFCAANPYSLLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.77
3 0.7
4 0.64
5 0.55
6 0.46
7 0.44
8 0.42
9 0.39
10 0.37
11 0.42
12 0.44
13 0.45
14 0.49
15 0.5
16 0.49
17 0.55
18 0.56
19 0.52
20 0.5
21 0.51
22 0.47
23 0.42
24 0.34
25 0.28
26 0.25
27 0.21
28 0.18
29 0.16
30 0.15
31 0.12
32 0.12
33 0.09
34 0.08
35 0.08
36 0.06
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.07
44 0.07
45 0.07
46 0.06
47 0.06
48 0.06
49 0.06
50 0.07
51 0.06
52 0.05
53 0.06
54 0.07
55 0.06
56 0.06
57 0.07
58 0.08
59 0.08
60 0.09
61 0.08
62 0.1
63 0.1
64 0.09
65 0.08
66 0.08
67 0.08
68 0.07
69 0.07
70 0.05
71 0.05
72 0.05
73 0.05
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.06
80 0.06
81 0.07
82 0.07
83 0.08
84 0.07
85 0.08
86 0.07
87 0.06
88 0.07
89 0.05
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.06
96 0.07
97 0.08
98 0.08
99 0.08
100 0.09
101 0.09
102 0.09
103 0.09
104 0.08
105 0.07
106 0.07
107 0.07
108 0.06
109 0.05
110 0.04
111 0.03
112 0.04
113 0.04
114 0.05
115 0.05
116 0.07
117 0.07
118 0.08
119 0.08
120 0.07
121 0.06
122 0.06
123 0.06
124 0.04
125 0.04
126 0.04
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.03
133 0.04
134 0.04
135 0.04
136 0.04
137 0.08
138 0.09
139 0.12
140 0.15
141 0.17
142 0.16
143 0.17
144 0.17
145 0.14
146 0.14
147 0.11
148 0.09
149 0.08
150 0.08
151 0.1
152 0.12
153 0.13
154 0.14
155 0.14
156 0.14
157 0.13
158 0.15
159 0.15
160 0.13
161 0.12
162 0.11
163 0.11
164 0.1
165 0.1
166 0.09
167 0.08
168 0.09
169 0.09
170 0.09
171 0.08
172 0.08
173 0.08
174 0.07
175 0.07
176 0.09
177 0.09
178 0.09
179 0.08
180 0.09
181 0.08
182 0.09
183 0.08
184 0.05
185 0.05
186 0.05
187 0.07
188 0.06
189 0.08
190 0.08
191 0.1
192 0.11
193 0.11
194 0.12
195 0.14
196 0.15
197 0.17
198 0.17
199 0.16
200 0.17
201 0.18
202 0.19
203 0.18
204 0.19
205 0.17
206 0.18
207 0.2
208 0.2
209 0.22
210 0.21
211 0.27
212 0.28
213 0.34
214 0.34
215 0.35
216 0.35
217 0.34
218 0.34
219 0.27
220 0.25
221 0.18
222 0.17
223 0.14
224 0.12
225 0.12
226 0.11
227 0.14
228 0.13
229 0.16
230 0.22
231 0.27
232 0.27
233 0.26
234 0.26
235 0.3
236 0.32
237 0.34
238 0.29
239 0.3
240 0.35
241 0.37
242 0.36
243 0.3
244 0.36
245 0.39
246 0.48
247 0.52
248 0.53
249 0.58
250 0.68
251 0.77
252 0.77
253 0.79
254 0.78
255 0.78
256 0.8
257 0.81
258 0.76
259 0.75
260 0.71
261 0.67
262 0.67
263 0.68
264 0.62
265 0.59
266 0.61
267 0.57
268 0.6
269 0.6
270 0.6
271 0.57
272 0.62
273 0.62
274 0.63
275 0.64
276 0.67
277 0.68
278 0.63
279 0.6
280 0.61
281 0.63
282 0.61
283 0.64
284 0.62
285 0.62
286 0.67
287 0.72
288 0.72
289 0.75
290 0.79
291 0.8
292 0.81
293 0.78
294 0.71
295 0.65
296 0.56
297 0.45
298 0.35
299 0.25
300 0.15
301 0.1
302 0.08
303 0.06
304 0.05
305 0.05
306 0.05
307 0.05
308 0.05
309 0.05
310 0.07
311 0.08
312 0.09
313 0.15
314 0.2
315 0.23
316 0.28
317 0.34
318 0.4
319 0.47
320 0.5
321 0.53
322 0.59
323 0.61
324 0.56
325 0.52
326 0.46
327 0.37
328 0.34
329 0.25
330 0.15
331 0.11
332 0.1
333 0.1
334 0.1
335 0.09
336 0.08
337 0.08
338 0.07
339 0.07
340 0.07
341 0.05
342 0.04
343 0.05
344 0.05
345 0.05
346 0.05
347 0.05
348 0.05
349 0.05
350 0.04
351 0.04
352 0.04
353 0.04
354 0.04
355 0.05
356 0.05
357 0.06
358 0.06
359 0.05
360 0.06
361 0.07
362 0.08
363 0.09
364 0.1
365 0.17
366 0.21
367 0.25
368 0.26
369 0.25
370 0.26
371 0.25
372 0.26
373 0.2
374 0.18
375 0.17
376 0.16
377 0.16
378 0.18
379 0.17
380 0.17