Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q3ETG9

Protein Details
Accession A0A1Q3ETG9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
42-68FIKLLLSNRRRKRRRYMRRSDRVFVSQHydrophilic
NLS Segment(s)
PositionSequence
50-59RRRKRRRYMR
Subcellular Location(s) cysk 16, cyto 7, cyto_nucl 5.833, cyto_mito 4.333
Family & Domain DBs
Amino Acid Sequences MGDVSMGLAYLCGGCCCLKDTDPGPEGSQITRIIRETRTEGFIKLLLSNRRRKRRRYMRRSDRVFVSQWENIIVKSRLSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.1
4 0.12
5 0.13
6 0.18
7 0.2
8 0.26
9 0.27
10 0.28
11 0.27
12 0.27
13 0.27
14 0.22
15 0.22
16 0.18
17 0.17
18 0.17
19 0.17
20 0.17
21 0.17
22 0.19
23 0.19
24 0.19
25 0.21
26 0.21
27 0.19
28 0.18
29 0.18
30 0.16
31 0.15
32 0.18
33 0.22
34 0.28
35 0.37
36 0.46
37 0.56
38 0.62
39 0.68
40 0.74
41 0.78
42 0.83
43 0.85
44 0.87
45 0.88
46 0.91
47 0.92
48 0.86
49 0.8
50 0.73
51 0.65
52 0.57
53 0.52
54 0.43
55 0.36
56 0.34
57 0.29
58 0.24
59 0.29
60 0.26