Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q3DXI0

Protein Details
Accession A0A1Q3DXI0    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPRENRKRGKKHKFKTTDETIPYBasic
NLS Segment(s)
PositionSequence
5-13NRKRGKKHK
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040000  NOP9  
Gene Ontology GO:0003723  F:RNA binding  
Amino Acid Sequences MPRENRKRGKKHKFKTTDETIPYASSEPQAELEPQVGPSWIVTASGEDSEFNPEAPFGYVDADVKAYFRTVDLQIREWQEGQQEHLDGDANVDPNAEKRMFFVAALSEMRGKEKQLATDPDCSIILERMAYSMDDFVRRVFLDSLSASKPYVAAETVARETMGIVAPASEAASEGHLRTAVDLILDICKVGLNASSFDSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.88
3 0.86
4 0.84
5 0.77
6 0.71
7 0.61
8 0.52
9 0.45
10 0.37
11 0.29
12 0.21
13 0.18
14 0.15
15 0.15
16 0.15
17 0.15
18 0.14
19 0.14
20 0.13
21 0.12
22 0.12
23 0.11
24 0.1
25 0.08
26 0.09
27 0.07
28 0.07
29 0.07
30 0.07
31 0.08
32 0.09
33 0.09
34 0.08
35 0.09
36 0.13
37 0.13
38 0.12
39 0.11
40 0.11
41 0.11
42 0.12
43 0.11
44 0.07
45 0.08
46 0.09
47 0.09
48 0.09
49 0.1
50 0.09
51 0.09
52 0.08
53 0.07
54 0.07
55 0.07
56 0.09
57 0.11
58 0.16
59 0.17
60 0.2
61 0.24
62 0.26
63 0.27
64 0.24
65 0.23
66 0.22
67 0.21
68 0.2
69 0.17
70 0.15
71 0.14
72 0.14
73 0.13
74 0.09
75 0.1
76 0.09
77 0.08
78 0.07
79 0.08
80 0.07
81 0.07
82 0.1
83 0.09
84 0.08
85 0.08
86 0.11
87 0.11
88 0.11
89 0.1
90 0.08
91 0.09
92 0.09
93 0.09
94 0.09
95 0.09
96 0.11
97 0.11
98 0.11
99 0.15
100 0.16
101 0.18
102 0.21
103 0.27
104 0.27
105 0.32
106 0.32
107 0.28
108 0.27
109 0.24
110 0.2
111 0.15
112 0.12
113 0.07
114 0.07
115 0.06
116 0.06
117 0.06
118 0.06
119 0.07
120 0.08
121 0.09
122 0.09
123 0.09
124 0.11
125 0.11
126 0.13
127 0.12
128 0.11
129 0.12
130 0.13
131 0.16
132 0.15
133 0.16
134 0.14
135 0.13
136 0.13
137 0.11
138 0.12
139 0.09
140 0.09
141 0.09
142 0.13
143 0.14
144 0.14
145 0.13
146 0.12
147 0.11
148 0.12
149 0.11
150 0.08
151 0.06
152 0.06
153 0.07
154 0.07
155 0.07
156 0.05
157 0.05
158 0.05
159 0.08
160 0.09
161 0.09
162 0.1
163 0.11
164 0.11
165 0.11
166 0.12
167 0.09
168 0.08
169 0.08
170 0.08
171 0.09
172 0.09
173 0.08
174 0.07
175 0.08
176 0.08
177 0.08
178 0.1
179 0.1
180 0.12