Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q3E580

Protein Details
Accession A0A1Q3E580    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
46-71KLAERHEKKGPKRRRLESERWRRLFABasic
NLS Segment(s)
PositionSequence
38-72RNKVRKQLKLAERHEKKGPKRRRLESERWRRLFAH
85-87RRR
Subcellular Location(s) nucl 12, cyto 10, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MSIAEAGLVNDPYSGRSAHVVDGNLADAFRRLDMILARNKVRKQLKLAERHEKKGPKRRRLESERWRRLFAHEVRKNVQLVTKIRRRGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.12
4 0.13
5 0.15
6 0.18
7 0.17
8 0.16
9 0.16
10 0.16
11 0.13
12 0.12
13 0.1
14 0.08
15 0.08
16 0.07
17 0.07
18 0.06
19 0.07
20 0.09
21 0.14
22 0.18
23 0.21
24 0.24
25 0.28
26 0.29
27 0.36
28 0.39
29 0.38
30 0.37
31 0.43
32 0.48
33 0.53
34 0.59
35 0.62
36 0.61
37 0.62
38 0.64
39 0.62
40 0.64
41 0.65
42 0.69
43 0.68
44 0.73
45 0.78
46 0.81
47 0.82
48 0.84
49 0.85
50 0.86
51 0.86
52 0.8
53 0.75
54 0.66
55 0.61
56 0.6
57 0.57
58 0.57
59 0.52
60 0.55
61 0.55
62 0.58
63 0.55
64 0.46
65 0.43
66 0.39
67 0.4
68 0.44
69 0.49