Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4ELH0

Protein Details
Accession A0A0C4ELH0    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
13-42GKVRSQCPKVAKQERTKKKLQGRAKKRACYHydrophilic
NLS Segment(s)
PositionSequence
23-39AKQERTKKKLQGRAKKR
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences LHLPVHGSLARAGKVRSQCPKVAKQERTKKKLQGRAKKRACYNNRFAITTPHGGKRRMNPAPAGKMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.36
3 0.41
4 0.42
5 0.45
6 0.49
7 0.57
8 0.62
9 0.66
10 0.67
11 0.69
12 0.75
13 0.8
14 0.8
15 0.78
16 0.76
17 0.74
18 0.75
19 0.75
20 0.75
21 0.74
22 0.79
23 0.81
24 0.79
25 0.78
26 0.79
27 0.77
28 0.75
29 0.73
30 0.71
31 0.66
32 0.61
33 0.54
34 0.51
35 0.46
36 0.45
37 0.41
38 0.4
39 0.42
40 0.44
41 0.48
42 0.5
43 0.56
44 0.55
45 0.55
46 0.54
47 0.59