Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q3E827

Protein Details
Accession A0A1Q3E827    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
223-251KGEASRQGGRNRRRTKRRRTTIAEKGHICBasic
NLS Segment(s)
PositionSequence
228-241RQGGRNRRRTKRRR
Subcellular Location(s) nucl 20, cyto_nucl 14.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MERIYEVSININAAELLQEAYVRQCVAGFDESDLSELEEELQDKKTTPNTPGDHSDLNVPASLASSSSSAKSILPSLASSHLPPRMTLNAPRDHTASNTPGDHCDLHLPASFGSVSSSKPFLPSLASSHLRPYTPSDIPHDRSNLHLTASTMSSSSCLLDDSPNASLLSTTKRFDQAFNPTAKPVPLPNPLGPGAYDRPSSSSVKLGKRAVGLSGSNEQDEMKGEASRQGGRNRRRTKRRRTTIAEKGHICPEALDGKVRPALPISAHLPSESLLIASGAWVGIDSDFYGAKKARTVEELVDKGMRVIAYKKGSVDVRLLLPCPNPPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.07
3 0.07
4 0.06
5 0.07
6 0.07
7 0.09
8 0.11
9 0.1
10 0.1
11 0.1
12 0.1
13 0.14
14 0.16
15 0.15
16 0.15
17 0.17
18 0.17
19 0.17
20 0.16
21 0.13
22 0.11
23 0.1
24 0.1
25 0.09
26 0.1
27 0.11
28 0.14
29 0.14
30 0.15
31 0.18
32 0.24
33 0.26
34 0.29
35 0.37
36 0.37
37 0.42
38 0.46
39 0.47
40 0.42
41 0.39
42 0.39
43 0.31
44 0.29
45 0.24
46 0.19
47 0.14
48 0.13
49 0.13
50 0.08
51 0.08
52 0.08
53 0.09
54 0.1
55 0.11
56 0.11
57 0.11
58 0.12
59 0.13
60 0.12
61 0.12
62 0.12
63 0.14
64 0.16
65 0.16
66 0.16
67 0.19
68 0.22
69 0.21
70 0.21
71 0.23
72 0.25
73 0.27
74 0.32
75 0.35
76 0.38
77 0.4
78 0.41
79 0.39
80 0.35
81 0.34
82 0.32
83 0.28
84 0.24
85 0.24
86 0.23
87 0.22
88 0.24
89 0.22
90 0.18
91 0.18
92 0.16
93 0.15
94 0.16
95 0.15
96 0.12
97 0.14
98 0.13
99 0.1
100 0.11
101 0.1
102 0.09
103 0.11
104 0.12
105 0.11
106 0.12
107 0.13
108 0.11
109 0.13
110 0.13
111 0.14
112 0.19
113 0.21
114 0.2
115 0.24
116 0.25
117 0.23
118 0.23
119 0.25
120 0.25
121 0.25
122 0.26
123 0.28
124 0.32
125 0.35
126 0.37
127 0.34
128 0.28
129 0.29
130 0.31
131 0.25
132 0.2
133 0.18
134 0.15
135 0.14
136 0.15
137 0.12
138 0.09
139 0.08
140 0.08
141 0.07
142 0.07
143 0.05
144 0.05
145 0.06
146 0.06
147 0.07
148 0.08
149 0.08
150 0.09
151 0.09
152 0.08
153 0.08
154 0.08
155 0.12
156 0.13
157 0.13
158 0.13
159 0.17
160 0.18
161 0.2
162 0.23
163 0.26
164 0.29
165 0.32
166 0.32
167 0.29
168 0.29
169 0.28
170 0.24
171 0.19
172 0.19
173 0.2
174 0.23
175 0.23
176 0.26
177 0.26
178 0.25
179 0.23
180 0.22
181 0.19
182 0.18
183 0.18
184 0.14
185 0.17
186 0.2
187 0.21
188 0.18
189 0.22
190 0.27
191 0.3
192 0.35
193 0.34
194 0.33
195 0.33
196 0.32
197 0.27
198 0.23
199 0.2
200 0.17
201 0.2
202 0.18
203 0.16
204 0.16
205 0.15
206 0.13
207 0.14
208 0.13
209 0.1
210 0.09
211 0.1
212 0.13
213 0.16
214 0.2
215 0.23
216 0.3
217 0.38
218 0.46
219 0.56
220 0.63
221 0.71
222 0.78
223 0.84
224 0.87
225 0.9
226 0.91
227 0.91
228 0.9
229 0.89
230 0.88
231 0.88
232 0.84
233 0.76
234 0.68
235 0.62
236 0.53
237 0.43
238 0.33
239 0.26
240 0.22
241 0.2
242 0.2
243 0.16
244 0.19
245 0.22
246 0.22
247 0.2
248 0.17
249 0.19
250 0.17
251 0.21
252 0.21
253 0.2
254 0.2
255 0.2
256 0.19
257 0.17
258 0.17
259 0.13
260 0.09
261 0.07
262 0.06
263 0.06
264 0.06
265 0.06
266 0.04
267 0.04
268 0.04
269 0.04
270 0.04
271 0.05
272 0.05
273 0.06
274 0.07
275 0.08
276 0.12
277 0.13
278 0.15
279 0.18
280 0.2
281 0.22
282 0.25
283 0.28
284 0.29
285 0.36
286 0.37
287 0.36
288 0.35
289 0.32
290 0.29
291 0.28
292 0.22
293 0.16
294 0.17
295 0.22
296 0.25
297 0.27
298 0.28
299 0.32
300 0.34
301 0.34
302 0.35
303 0.31
304 0.31
305 0.32
306 0.32
307 0.3
308 0.3