Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q3E5M2

Protein Details
Accession A0A1Q3E5M2    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
42-67ILHIHYRRRTFRRRVCAGKNLERRRRBasic
NLS Segment(s)
PositionSequence
60-67KNLERRRR
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 7
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTIYLQPQPISEPIQPSRSPPAKASLISPASTTTTLLHILHILHIHYRRRTFRRRVCAGKNLERRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.34
4 0.41
5 0.41
6 0.41
7 0.35
8 0.38
9 0.35
10 0.35
11 0.34
12 0.31
13 0.28
14 0.26
15 0.25
16 0.2
17 0.18
18 0.18
19 0.17
20 0.1
21 0.1
22 0.11
23 0.1
24 0.1
25 0.09
26 0.09
27 0.09
28 0.09
29 0.09
30 0.12
31 0.17
32 0.22
33 0.27
34 0.34
35 0.41
36 0.5
37 0.59
38 0.66
39 0.71
40 0.76
41 0.8
42 0.83
43 0.82
44 0.83
45 0.82
46 0.82
47 0.83