Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q3ENE1

Protein Details
Accession A0A1Q3ENE1    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-37TAGPSRRTTNWRRPLKRRRIVEESKEHydrophilic
NLS Segment(s)
PositionSequence
23-29RRPLKRR
Subcellular Location(s) mito 21, nucl 5
Family & Domain DBs
Amino Acid Sequences MSLMGMGGGPATAGPSRRTTNWRRPLKRRRIVEESKEEGEEEEDREVEEKEKETEKDGEGEEEETVPTEAQSEKGKERAVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.16
3 0.19
4 0.23
5 0.32
6 0.39
7 0.48
8 0.57
9 0.65
10 0.7
11 0.78
12 0.85
13 0.88
14 0.88
15 0.85
16 0.83
17 0.81
18 0.8
19 0.77
20 0.74
21 0.68
22 0.6
23 0.53
24 0.44
25 0.35
26 0.29
27 0.21
28 0.14
29 0.09
30 0.08
31 0.08
32 0.08
33 0.09
34 0.09
35 0.09
36 0.09
37 0.12
38 0.15
39 0.16
40 0.18
41 0.2
42 0.2
43 0.21
44 0.21
45 0.2
46 0.18
47 0.18
48 0.15
49 0.13
50 0.12
51 0.1
52 0.1
53 0.08
54 0.07
55 0.08
56 0.08
57 0.11
58 0.17
59 0.2
60 0.23
61 0.28