Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q3ET05

Protein Details
Accession A0A1Q3ET05   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGKRKKSSRKPGPARVKVPLDBasic
NLS Segment(s)
PositionSequence
3-15KRKKSSRKPGPAR
Subcellular Location(s) mito 16, nucl 7.5, cyto_nucl 5.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0003746  F:translation elongation factor activity  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRKPGPARVKVPLDTAFTCLFCHHDKSVTVRIDRKEGVAQLICRVCDQRYQSKVNHLTEPIDIYSEWIDAADEAQRVGESSTVRRPAASSSRPVPARAPSVDDSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.83
3 0.78
4 0.68
5 0.62
6 0.55
7 0.48
8 0.39
9 0.37
10 0.31
11 0.25
12 0.24
13 0.2
14 0.2
15 0.18
16 0.21
17 0.19
18 0.2
19 0.21
20 0.26
21 0.33
22 0.34
23 0.36
24 0.37
25 0.38
26 0.39
27 0.38
28 0.34
29 0.29
30 0.25
31 0.25
32 0.21
33 0.2
34 0.2
35 0.21
36 0.19
37 0.17
38 0.18
39 0.15
40 0.17
41 0.21
42 0.24
43 0.28
44 0.31
45 0.32
46 0.4
47 0.46
48 0.44
49 0.42
50 0.35
51 0.32
52 0.28
53 0.29
54 0.2
55 0.14
56 0.11
57 0.1
58 0.1
59 0.09
60 0.08
61 0.06
62 0.06
63 0.05
64 0.06
65 0.07
66 0.06
67 0.06
68 0.06
69 0.06
70 0.07
71 0.07
72 0.09
73 0.09
74 0.12
75 0.19
76 0.24
77 0.24
78 0.24
79 0.25
80 0.29
81 0.36
82 0.37
83 0.36
84 0.36
85 0.44
86 0.45
87 0.46
88 0.43
89 0.4
90 0.42
91 0.37
92 0.4