Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q3EHH9

Protein Details
Accession A0A1Q3EHH9   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
123-145MKACYSKKAKTPKNTSSPPRSSSHydrophilic
NLS Segment(s)
PositionSequence
84-95AKTSKAPKEKRP
Subcellular Location(s) extr 12, mito 7, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
IPR006780  YABBY  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF04690  YABBY  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MLTFYSHHNLYSLSLGPFWLLGSQTGRGFGNPSFCQSSIIPTSSLLILHCSSADLISTFKYLLLEMPKASSTSTSKAASKGANAKTSKAPKEKRPPSAYNIFVSEKIKSWKASNPKANAKDAMKACYSKKAKTPKNTSSPPRSSSLPAADDNDVPSSDSVNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.14
4 0.14
5 0.12
6 0.1
7 0.08
8 0.09
9 0.11
10 0.14
11 0.14
12 0.16
13 0.16
14 0.15
15 0.17
16 0.16
17 0.22
18 0.19
19 0.23
20 0.25
21 0.25
22 0.28
23 0.25
24 0.29
25 0.25
26 0.26
27 0.22
28 0.18
29 0.19
30 0.16
31 0.17
32 0.11
33 0.11
34 0.1
35 0.1
36 0.09
37 0.09
38 0.08
39 0.08
40 0.08
41 0.06
42 0.06
43 0.06
44 0.07
45 0.06
46 0.07
47 0.07
48 0.07
49 0.08
50 0.1
51 0.11
52 0.1
53 0.12
54 0.12
55 0.12
56 0.12
57 0.12
58 0.12
59 0.13
60 0.16
61 0.17
62 0.18
63 0.18
64 0.2
65 0.18
66 0.19
67 0.24
68 0.23
69 0.28
70 0.27
71 0.29
72 0.33
73 0.38
74 0.42
75 0.44
76 0.46
77 0.49
78 0.6
79 0.65
80 0.68
81 0.7
82 0.67
83 0.65
84 0.67
85 0.6
86 0.51
87 0.47
88 0.39
89 0.34
90 0.32
91 0.26
92 0.22
93 0.23
94 0.23
95 0.21
96 0.22
97 0.27
98 0.35
99 0.44
100 0.49
101 0.53
102 0.6
103 0.62
104 0.63
105 0.62
106 0.54
107 0.52
108 0.46
109 0.42
110 0.36
111 0.35
112 0.33
113 0.38
114 0.4
115 0.36
116 0.42
117 0.5
118 0.56
119 0.63
120 0.71
121 0.71
122 0.77
123 0.82
124 0.83
125 0.83
126 0.81
127 0.74
128 0.68
129 0.61
130 0.56
131 0.52
132 0.49
133 0.42
134 0.38
135 0.38
136 0.36
137 0.34
138 0.32
139 0.28
140 0.22
141 0.2
142 0.17