Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3B1Q3

Protein Details
Accession G3B1Q3   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
59-81LKYFSKSKYLQPKKPHRNSVVGTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11.5, mito_nucl 10.833, nucl 9, cyto_nucl 7.833, cyto 5.5
Family & Domain DBs
KEGG cten:CANTEDRAFT_113270  -  
Amino Acid Sequences MPFTFSVYSRKVLDLNYEYIKKNLLLVILDRSEVPRLLVAHLHSLQKLCLHKYITAHMLKYFSKSKYLQPKKPHRNSVVGTQQSAPYYSGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.33
4 0.34
5 0.34
6 0.32
7 0.33
8 0.26
9 0.23
10 0.19
11 0.15
12 0.12
13 0.12
14 0.15
15 0.14
16 0.14
17 0.13
18 0.13
19 0.13
20 0.13
21 0.12
22 0.1
23 0.1
24 0.1
25 0.12
26 0.11
27 0.14
28 0.16
29 0.17
30 0.15
31 0.15
32 0.15
33 0.17
34 0.18
35 0.15
36 0.17
37 0.17
38 0.19
39 0.2
40 0.23
41 0.25
42 0.25
43 0.25
44 0.23
45 0.24
46 0.23
47 0.26
48 0.28
49 0.23
50 0.27
51 0.28
52 0.35
53 0.43
54 0.53
55 0.57
56 0.62
57 0.73
58 0.78
59 0.86
60 0.88
61 0.82
62 0.81
63 0.76
64 0.75
65 0.74
66 0.66
67 0.59
68 0.51
69 0.48
70 0.4
71 0.39