Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q3EPB6

Protein Details
Accession A0A1Q3EPB6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
5-28SIWIRRKVPVWRLSKKKKAFHSIQHydrophilic
NLS Segment(s)
PositionSequence
18-22SKKKK
Subcellular Location(s) mito 15, plas 5, E.R. 4, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFAGSIWIRRKVPVWRLSKKKKAFHSIQTRLYPLPLRPSFWPFELSVFIVPAFLFKFAFSVPSLVWIVVVAVTFAGARWH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.59
3 0.69
4 0.78
5 0.83
6 0.83
7 0.82
8 0.82
9 0.82
10 0.78
11 0.78
12 0.78
13 0.76
14 0.74
15 0.69
16 0.63
17 0.54
18 0.49
19 0.41
20 0.31
21 0.33
22 0.26
23 0.25
24 0.25
25 0.28
26 0.28
27 0.26
28 0.27
29 0.18
30 0.18
31 0.17
32 0.16
33 0.13
34 0.11
35 0.1
36 0.08
37 0.08
38 0.07
39 0.06
40 0.06
41 0.06
42 0.06
43 0.07
44 0.07
45 0.09
46 0.08
47 0.09
48 0.09
49 0.12
50 0.13
51 0.12
52 0.12
53 0.1
54 0.1
55 0.09
56 0.09
57 0.05
58 0.04
59 0.04
60 0.04