Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q3EK02

Protein Details
Accession A0A1Q3EK02   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
17-42LFSSKLKESKKSRKEWEKKEEKERLPBasic
NLS Segment(s)
PositionSequence
22-60LKESKKSRKEWEKKEEKERLPGRGAKGGREKGGRGEGRG
Subcellular Location(s) mito 13, cyto 9, mito_nucl 9
Family & Domain DBs
Amino Acid Sequences MYAVEGMLKGVWRTTELFSSKLKESKKSRKEWEKKEEKERLPGRGAKGGREKGGRGEGRGVEGEKELGEREGEEKWFVPPLILIHWAEKEDEKIPRDVGDVIHLPIHLFPHHLIPPHPTNTNLLSQPTLSYP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.21
3 0.22
4 0.25
5 0.27
6 0.3
7 0.33
8 0.36
9 0.37
10 0.39
11 0.47
12 0.56
13 0.62
14 0.67
15 0.74
16 0.79
17 0.87
18 0.88
19 0.89
20 0.88
21 0.87
22 0.88
23 0.87
24 0.79
25 0.79
26 0.72
27 0.67
28 0.62
29 0.58
30 0.51
31 0.48
32 0.46
33 0.41
34 0.46
35 0.43
36 0.41
37 0.39
38 0.36
39 0.32
40 0.4
41 0.34
42 0.27
43 0.28
44 0.24
45 0.23
46 0.24
47 0.2
48 0.13
49 0.12
50 0.11
51 0.08
52 0.08
53 0.06
54 0.06
55 0.05
56 0.05
57 0.06
58 0.07
59 0.07
60 0.08
61 0.08
62 0.08
63 0.1
64 0.09
65 0.08
66 0.08
67 0.08
68 0.09
69 0.11
70 0.11
71 0.11
72 0.12
73 0.13
74 0.13
75 0.13
76 0.14
77 0.15
78 0.19
79 0.2
80 0.21
81 0.21
82 0.2
83 0.21
84 0.2
85 0.17
86 0.16
87 0.16
88 0.15
89 0.15
90 0.15
91 0.13
92 0.13
93 0.15
94 0.11
95 0.11
96 0.12
97 0.16
98 0.19
99 0.21
100 0.21
101 0.26
102 0.32
103 0.34
104 0.36
105 0.31
106 0.33
107 0.34
108 0.38
109 0.34
110 0.31
111 0.28
112 0.26