Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q3E5M4

Protein Details
Accession A0A1Q3E5M4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
261-280STTVNYRKPKDKTNEIPSFSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, cyto 7, extr 6, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
IPR020904  Sc_DH/Rdtase_CS  
IPR002347  SDR_fam  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF00106  adh_short  
PROSITE View protein in PROSITE  
PS00061  ADH_SHORT  
Amino Acid Sequences MSIFNASRILGKTVLVTGASAGIGAATALLFAKGGSNVILVARRAEAVKIVADACAAAFEASGLKEGGRFAAVQLDVSDKAQVASFWDKVPQDLRNVDILVNNAGFVLGVDQVGNIKDEDIEAMFATNVLGLISVTQLLLKDFKVKQSGHVINLGSIAGREAYAGGSIYTATKHAVHAFTASMMRELVNTPIRVTEIQPGMVETEFSIVRFRGDAGAAKKVYDGLEPLTATDIAEEIVWAAARPPHVNIAEVLVLPVNQASTTVNYRKPKDKTNEIPSFSSNGVGNVKSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.15
3 0.13
4 0.1
5 0.1
6 0.09
7 0.08
8 0.06
9 0.05
10 0.04
11 0.04
12 0.04
13 0.02
14 0.03
15 0.03
16 0.03
17 0.04
18 0.04
19 0.05
20 0.06
21 0.06
22 0.07
23 0.07
24 0.07
25 0.09
26 0.12
27 0.11
28 0.12
29 0.12
30 0.13
31 0.13
32 0.13
33 0.13
34 0.12
35 0.12
36 0.12
37 0.12
38 0.11
39 0.1
40 0.1
41 0.08
42 0.06
43 0.06
44 0.04
45 0.04
46 0.04
47 0.05
48 0.05
49 0.07
50 0.06
51 0.06
52 0.07
53 0.08
54 0.08
55 0.08
56 0.08
57 0.07
58 0.12
59 0.12
60 0.11
61 0.11
62 0.13
63 0.13
64 0.14
65 0.14
66 0.09
67 0.09
68 0.09
69 0.09
70 0.1
71 0.14
72 0.15
73 0.14
74 0.18
75 0.18
76 0.2
77 0.23
78 0.21
79 0.22
80 0.22
81 0.23
82 0.21
83 0.22
84 0.2
85 0.18
86 0.17
87 0.14
88 0.13
89 0.11
90 0.08
91 0.07
92 0.07
93 0.05
94 0.05
95 0.04
96 0.04
97 0.04
98 0.04
99 0.05
100 0.05
101 0.06
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.03
115 0.03
116 0.03
117 0.03
118 0.02
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.04
125 0.04
126 0.05
127 0.05
128 0.11
129 0.11
130 0.14
131 0.2
132 0.2
133 0.22
134 0.3
135 0.32
136 0.28
137 0.31
138 0.28
139 0.23
140 0.23
141 0.2
142 0.1
143 0.08
144 0.07
145 0.04
146 0.04
147 0.03
148 0.03
149 0.03
150 0.04
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.05
158 0.06
159 0.06
160 0.07
161 0.1
162 0.1
163 0.1
164 0.11
165 0.1
166 0.1
167 0.11
168 0.11
169 0.09
170 0.08
171 0.08
172 0.08
173 0.08
174 0.12
175 0.14
176 0.14
177 0.14
178 0.14
179 0.16
180 0.16
181 0.17
182 0.19
183 0.16
184 0.17
185 0.16
186 0.16
187 0.16
188 0.15
189 0.14
190 0.08
191 0.08
192 0.08
193 0.08
194 0.09
195 0.08
196 0.09
197 0.09
198 0.09
199 0.09
200 0.1
201 0.15
202 0.16
203 0.23
204 0.23
205 0.22
206 0.22
207 0.22
208 0.22
209 0.17
210 0.16
211 0.11
212 0.14
213 0.14
214 0.14
215 0.14
216 0.13
217 0.12
218 0.11
219 0.09
220 0.06
221 0.06
222 0.06
223 0.04
224 0.05
225 0.05
226 0.04
227 0.06
228 0.07
229 0.1
230 0.11
231 0.12
232 0.18
233 0.19
234 0.2
235 0.19
236 0.2
237 0.2
238 0.18
239 0.17
240 0.12
241 0.11
242 0.1
243 0.1
244 0.07
245 0.05
246 0.06
247 0.07
248 0.11
249 0.18
250 0.23
251 0.31
252 0.39
253 0.45
254 0.53
255 0.57
256 0.63
257 0.66
258 0.71
259 0.73
260 0.76
261 0.8
262 0.75
263 0.74
264 0.66
265 0.61
266 0.5
267 0.43
268 0.33
269 0.27
270 0.26