Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4EYH6

Protein Details
Accession A0A0C4EYH6    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
220-251LGPKTTGPPKPNRRPLARQKPKLNTPNPPSSNHydrophilic
NLS Segment(s)
PositionSequence
227-241PPKPNRRPLARQKPK
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MVLQDKYKRANSSRYRATHGGIQSNRQKAKAATASIGPSSPSQQQQPPAEDFPQLIQPSSAPPADDLQPSQTAETLLPLAHPPAAPPPPNPTFSRRQLASNAHRYLEPEPDPNEEPEPEIDLTYFVEKHRTKIEAEEVRSKEPDEEQDVDQSFDHLFKHSTRPGHVQHSLSSTGIHGSAGKPAKVFIEDSSSLGLEELDNERKKADATRELIARFSAHQLGPKTTGPPKPNRRPLARQKPKLNTPNPPSSNPKELVHPLDDEDFLDEVLNDSSGTYGKFKRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.71
3 0.66
4 0.64
5 0.6
6 0.56
7 0.55
8 0.48
9 0.52
10 0.53
11 0.59
12 0.59
13 0.53
14 0.51
15 0.43
16 0.49
17 0.47
18 0.42
19 0.35
20 0.35
21 0.36
22 0.34
23 0.33
24 0.25
25 0.2
26 0.2
27 0.23
28 0.23
29 0.25
30 0.29
31 0.36
32 0.4
33 0.43
34 0.45
35 0.44
36 0.42
37 0.38
38 0.35
39 0.29
40 0.3
41 0.26
42 0.21
43 0.18
44 0.17
45 0.18
46 0.2
47 0.19
48 0.13
49 0.13
50 0.16
51 0.18
52 0.19
53 0.17
54 0.17
55 0.19
56 0.19
57 0.18
58 0.16
59 0.15
60 0.13
61 0.13
62 0.11
63 0.08
64 0.08
65 0.08
66 0.09
67 0.09
68 0.09
69 0.08
70 0.14
71 0.18
72 0.19
73 0.2
74 0.27
75 0.29
76 0.32
77 0.35
78 0.34
79 0.37
80 0.41
81 0.47
82 0.41
83 0.4
84 0.43
85 0.49
86 0.51
87 0.53
88 0.49
89 0.43
90 0.42
91 0.41
92 0.37
93 0.34
94 0.28
95 0.22
96 0.22
97 0.25
98 0.26
99 0.26
100 0.26
101 0.2
102 0.19
103 0.16
104 0.17
105 0.13
106 0.12
107 0.1
108 0.09
109 0.09
110 0.09
111 0.1
112 0.07
113 0.16
114 0.16
115 0.18
116 0.2
117 0.21
118 0.21
119 0.23
120 0.31
121 0.28
122 0.31
123 0.37
124 0.36
125 0.36
126 0.36
127 0.33
128 0.26
129 0.21
130 0.2
131 0.16
132 0.17
133 0.16
134 0.19
135 0.19
136 0.19
137 0.18
138 0.16
139 0.12
140 0.11
141 0.1
142 0.08
143 0.09
144 0.1
145 0.15
146 0.18
147 0.2
148 0.22
149 0.28
150 0.31
151 0.36
152 0.38
153 0.34
154 0.32
155 0.33
156 0.31
157 0.25
158 0.22
159 0.16
160 0.12
161 0.11
162 0.1
163 0.07
164 0.06
165 0.13
166 0.14
167 0.14
168 0.14
169 0.14
170 0.15
171 0.15
172 0.16
173 0.11
174 0.15
175 0.15
176 0.16
177 0.17
178 0.16
179 0.14
180 0.13
181 0.12
182 0.06
183 0.07
184 0.1
185 0.16
186 0.17
187 0.17
188 0.18
189 0.18
190 0.19
191 0.22
192 0.26
193 0.26
194 0.29
195 0.33
196 0.37
197 0.37
198 0.37
199 0.33
200 0.27
201 0.2
202 0.2
203 0.2
204 0.16
205 0.21
206 0.22
207 0.25
208 0.27
209 0.27
210 0.29
211 0.32
212 0.38
213 0.4
214 0.48
215 0.56
216 0.64
217 0.72
218 0.77
219 0.79
220 0.82
221 0.87
222 0.88
223 0.88
224 0.87
225 0.87
226 0.88
227 0.89
228 0.89
229 0.85
230 0.84
231 0.8
232 0.82
233 0.76
234 0.72
235 0.7
236 0.67
237 0.67
238 0.6
239 0.54
240 0.49
241 0.5
242 0.5
243 0.44
244 0.39
245 0.34
246 0.33
247 0.32
248 0.26
249 0.23
250 0.18
251 0.15
252 0.14
253 0.11
254 0.1
255 0.1
256 0.1
257 0.07
258 0.07
259 0.08
260 0.09
261 0.1
262 0.14