Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3AYU6

Protein Details
Accession G3AYU6   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
62-90KKDKTLKKNDFMKWRRKQLNKVNTAKIKEHydrophilic
NLS Segment(s)
PositionSequence
62-78KKDKTLKKNDFMKWRRK
Subcellular Location(s) mito 15, mito_nucl 14.333, nucl 11.5, cyto_nucl 6.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG cten:CANTEDRAFT_101245  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MFRSLTVVRRFSISRSSLNTPKSSCVAGTVLNLKVKKAGDEPVALEDSDYPDWLWDSLDKGKKDKTLKKNDFMKWRRKQLNKVNTAKIKEKNFLSEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.42
4 0.44
5 0.47
6 0.49
7 0.42
8 0.42
9 0.39
10 0.34
11 0.27
12 0.23
13 0.2
14 0.17
15 0.17
16 0.18
17 0.18
18 0.22
19 0.22
20 0.2
21 0.22
22 0.21
23 0.21
24 0.19
25 0.2
26 0.17
27 0.18
28 0.19
29 0.18
30 0.18
31 0.16
32 0.14
33 0.11
34 0.11
35 0.1
36 0.09
37 0.07
38 0.06
39 0.07
40 0.07
41 0.07
42 0.05
43 0.08
44 0.14
45 0.2
46 0.21
47 0.24
48 0.27
49 0.33
50 0.42
51 0.49
52 0.53
53 0.59
54 0.65
55 0.71
56 0.77
57 0.78
58 0.8
59 0.78
60 0.79
61 0.77
62 0.8
63 0.81
64 0.8
65 0.84
66 0.83
67 0.86
68 0.85
69 0.84
70 0.83
71 0.81
72 0.79
73 0.77
74 0.74
75 0.69
76 0.66
77 0.61