Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4EYY3

Protein Details
Accession A0A0C4EYY3   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-35QGDPLLAPRKQKRRKNPTRNDSEYENHydrophilic
NLS Segment(s)
PositionSequence
18-24RKQKRRK
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 4, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MAQIKLHLLQGDPLLAPRKQKRRKNPTRNDSEYENMMVYDSFITPDELQAFEEGIFNDNQNEDLTLTSREDAFMNTLFDFNLWESASKKPTGASEEIEVVAVESEGEDTNWDPQELW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.27
4 0.35
5 0.45
6 0.53
7 0.63
8 0.71
9 0.78
10 0.88
11 0.91
12 0.93
13 0.92
14 0.93
15 0.9
16 0.83
17 0.76
18 0.68
19 0.58
20 0.48
21 0.38
22 0.27
23 0.2
24 0.16
25 0.11
26 0.09
27 0.07
28 0.06
29 0.06
30 0.08
31 0.08
32 0.09
33 0.1
34 0.09
35 0.09
36 0.09
37 0.09
38 0.07
39 0.08
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.06
48 0.06
49 0.05
50 0.06
51 0.07
52 0.07
53 0.08
54 0.08
55 0.08
56 0.08
57 0.08
58 0.08
59 0.09
60 0.09
61 0.1
62 0.09
63 0.1
64 0.09
65 0.09
66 0.09
67 0.08
68 0.09
69 0.08
70 0.09
71 0.1
72 0.15
73 0.17
74 0.17
75 0.17
76 0.16
77 0.19
78 0.23
79 0.24
80 0.22
81 0.22
82 0.23
83 0.23
84 0.22
85 0.18
86 0.13
87 0.11
88 0.08
89 0.06
90 0.04
91 0.05
92 0.05
93 0.06
94 0.07
95 0.08
96 0.13
97 0.14