Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q3E3H4

Protein Details
Accession A0A1Q3E3H4    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
235-254APPPSRTNPHPRPPPVHRPAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 8, cyto_nucl 7, mito 6, pero 5, nucl 4, cysk 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007239  Atg5  
IPR042526  Atg5_HR  
IPR042527  Atg5_UblA_dom  
Gene Ontology GO:0034045  C:phagophore assembly site membrane  
GO:0006914  P:autophagy  
Pfam View protein in Pfam  
PF04106  APG5  
Amino Acid Sequences MPEIRRFFMDLVFDETAAKDLKDEEWWFETTEGTLIKWHWPIGLIYDNHTISASLKPSTSRSSANVTPLRLILHLASPPNDKLLLSPSPEACKQAFMGQLKEADFIRWGSTKRMTGLRQQDQDGLWEGIKEHNFDDYWRVASKVTPTTAPTRAQSPAPPSSSASMVNRPPSADPGGPSERDGAYNVRSIPVRLYLPDGPVIQDLVPPMVDDNTPRTLSHYLTDHIPLLFPAAPPAPPPSRTNPHPRPPPVHRPAYALVQGIVMPSETEMAWLGGCLAGADGWVNVCIGINP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.22
4 0.19
5 0.16
6 0.1
7 0.11
8 0.12
9 0.18
10 0.19
11 0.21
12 0.24
13 0.25
14 0.26
15 0.25
16 0.24
17 0.18
18 0.19
19 0.15
20 0.12
21 0.13
22 0.13
23 0.17
24 0.18
25 0.18
26 0.16
27 0.17
28 0.17
29 0.19
30 0.25
31 0.21
32 0.23
33 0.28
34 0.28
35 0.27
36 0.27
37 0.23
38 0.17
39 0.21
40 0.19
41 0.14
42 0.15
43 0.17
44 0.2
45 0.24
46 0.25
47 0.24
48 0.24
49 0.3
50 0.32
51 0.38
52 0.39
53 0.35
54 0.34
55 0.32
56 0.3
57 0.24
58 0.22
59 0.15
60 0.13
61 0.14
62 0.15
63 0.16
64 0.18
65 0.18
66 0.18
67 0.18
68 0.15
69 0.14
70 0.17
71 0.18
72 0.18
73 0.2
74 0.2
75 0.24
76 0.25
77 0.26
78 0.22
79 0.21
80 0.19
81 0.19
82 0.23
83 0.21
84 0.22
85 0.21
86 0.23
87 0.22
88 0.23
89 0.2
90 0.15
91 0.14
92 0.12
93 0.13
94 0.13
95 0.14
96 0.17
97 0.2
98 0.21
99 0.22
100 0.28
101 0.27
102 0.32
103 0.41
104 0.44
105 0.43
106 0.43
107 0.42
108 0.36
109 0.36
110 0.31
111 0.22
112 0.15
113 0.13
114 0.12
115 0.13
116 0.13
117 0.13
118 0.1
119 0.11
120 0.11
121 0.12
122 0.14
123 0.12
124 0.13
125 0.12
126 0.12
127 0.11
128 0.12
129 0.15
130 0.15
131 0.15
132 0.14
133 0.15
134 0.19
135 0.22
136 0.22
137 0.2
138 0.2
139 0.2
140 0.2
141 0.21
142 0.22
143 0.23
144 0.23
145 0.24
146 0.22
147 0.22
148 0.22
149 0.22
150 0.19
151 0.19
152 0.2
153 0.22
154 0.21
155 0.2
156 0.2
157 0.2
158 0.21
159 0.18
160 0.16
161 0.2
162 0.22
163 0.22
164 0.22
165 0.21
166 0.18
167 0.18
168 0.19
169 0.15
170 0.14
171 0.16
172 0.15
173 0.15
174 0.15
175 0.15
176 0.14
177 0.16
178 0.15
179 0.13
180 0.17
181 0.17
182 0.18
183 0.2
184 0.19
185 0.17
186 0.16
187 0.16
188 0.12
189 0.11
190 0.1
191 0.08
192 0.08
193 0.07
194 0.07
195 0.07
196 0.07
197 0.08
198 0.12
199 0.15
200 0.16
201 0.16
202 0.2
203 0.2
204 0.21
205 0.23
206 0.22
207 0.19
208 0.2
209 0.22
210 0.2
211 0.18
212 0.17
213 0.14
214 0.14
215 0.14
216 0.11
217 0.12
218 0.12
219 0.12
220 0.13
221 0.2
222 0.2
223 0.22
224 0.26
225 0.32
226 0.39
227 0.45
228 0.54
229 0.58
230 0.64
231 0.71
232 0.75
233 0.75
234 0.77
235 0.82
236 0.79
237 0.77
238 0.69
239 0.65
240 0.61
241 0.59
242 0.53
243 0.43
244 0.34
245 0.27
246 0.25
247 0.2
248 0.17
249 0.1
250 0.07
251 0.06
252 0.07
253 0.06
254 0.07
255 0.08
256 0.08
257 0.07
258 0.07
259 0.07
260 0.06
261 0.06
262 0.05
263 0.05
264 0.04
265 0.05
266 0.05
267 0.05
268 0.05
269 0.06
270 0.06
271 0.06