Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q3EGZ3

Protein Details
Accession A0A1Q3EGZ3   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
4-24YEFELAKSKRQSKYKKGEAIVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR040446  RRP7  
IPR024326  RRP7_C  
Pfam View protein in Pfam  
PF12923  RRP7  
Amino Acid Sequences MDLYEFELAKSKRQSKYKKGEAIVDEDGFTLVTRGGAYGQTVGGGVAVATKKFQETGETSERTKKRSKEKTSFYAFQKAEKQRNELLQLKKNWELDKAKVEKLKASRRFNPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.68
3 0.78
4 0.81
5 0.81
6 0.76
7 0.75
8 0.68
9 0.64
10 0.57
11 0.47
12 0.37
13 0.29
14 0.26
15 0.18
16 0.15
17 0.09
18 0.05
19 0.05
20 0.04
21 0.04
22 0.05
23 0.05
24 0.06
25 0.06
26 0.06
27 0.06
28 0.06
29 0.05
30 0.04
31 0.04
32 0.03
33 0.05
34 0.05
35 0.05
36 0.05
37 0.06
38 0.06
39 0.07
40 0.07
41 0.08
42 0.1
43 0.16
44 0.21
45 0.23
46 0.24
47 0.31
48 0.33
49 0.33
50 0.38
51 0.39
52 0.44
53 0.53
54 0.62
55 0.63
56 0.7
57 0.74
58 0.75
59 0.75
60 0.68
61 0.67
62 0.58
63 0.53
64 0.55
65 0.54
66 0.55
67 0.51
68 0.53
69 0.48
70 0.52
71 0.54
72 0.53
73 0.52
74 0.52
75 0.54
76 0.54
77 0.55
78 0.55
79 0.5
80 0.5
81 0.47
82 0.44
83 0.49
84 0.48
85 0.49
86 0.49
87 0.49
88 0.49
89 0.54
90 0.59
91 0.59
92 0.64