Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q3ED83

Protein Details
Accession A0A1Q3ED83    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
40-62GAADGEKKKRKKARKETYSSYIYHydrophilic
NLS Segment(s)
PositionSequence
17-54AGKAPAKTEGSKAAKKTSAKSSAGAADGEKKKRKKARK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MAPKPASTAGKAPASTAGKAPAKTEGSKAAKKTSAKSSAGAADGEKKKRKKARKETYSSYIYKVLRQVHPDTGISNKAMAILNSFVNDIFERIATEASKLATYSKKSTISSREIQTSVRLILPGELAKHAISEGTKSVTKFSAGAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.3
4 0.32
5 0.31
6 0.32
7 0.32
8 0.31
9 0.32
10 0.32
11 0.33
12 0.35
13 0.38
14 0.42
15 0.44
16 0.43
17 0.45
18 0.47
19 0.49
20 0.49
21 0.49
22 0.46
23 0.44
24 0.41
25 0.37
26 0.35
27 0.31
28 0.22
29 0.24
30 0.28
31 0.34
32 0.39
33 0.4
34 0.48
35 0.57
36 0.66
37 0.69
38 0.74
39 0.78
40 0.81
41 0.86
42 0.84
43 0.82
44 0.78
45 0.68
46 0.59
47 0.54
48 0.44
49 0.37
50 0.35
51 0.33
52 0.3
53 0.32
54 0.32
55 0.28
56 0.3
57 0.28
58 0.24
59 0.21
60 0.19
61 0.15
62 0.13
63 0.1
64 0.1
65 0.1
66 0.09
67 0.08
68 0.08
69 0.08
70 0.09
71 0.09
72 0.07
73 0.08
74 0.08
75 0.07
76 0.06
77 0.06
78 0.06
79 0.07
80 0.08
81 0.07
82 0.07
83 0.08
84 0.08
85 0.08
86 0.08
87 0.11
88 0.14
89 0.17
90 0.21
91 0.25
92 0.28
93 0.29
94 0.35
95 0.38
96 0.4
97 0.43
98 0.43
99 0.42
100 0.4
101 0.39
102 0.37
103 0.33
104 0.28
105 0.22
106 0.19
107 0.15
108 0.15
109 0.16
110 0.14
111 0.13
112 0.13
113 0.13
114 0.13
115 0.13
116 0.12
117 0.11
118 0.1
119 0.12
120 0.13
121 0.16
122 0.19
123 0.19
124 0.22
125 0.22
126 0.22