Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q3EF90

Protein Details
Accession A0A1Q3EF90    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
28-47KEVLRRLRKHRLYANPRSANHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12cyto_nucl 12, nucl 8, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
IPR043128  Rev_trsase/Diguanyl_cyclase  
IPR000477  RT_dom  
IPR041373  RT_RNaseH  
Pfam View protein in Pfam  
PF17917  RT_RNaseH  
PF00078  RVT_1  
Amino Acid Sequences MLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPRSANIHPLAFLSRMLHAAELNYDTHDKELLAIFEAFKAWRHYLEGLGDPVDVITDHKNLEYFQVNPHNFRPIFTNEQLTASLRATFLEGPVLRASIITDIEALHQAIILALPADPSSAMNVGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.07
6 0.09
7 0.12
8 0.14
9 0.17
10 0.23
11 0.24
12 0.27
13 0.32
14 0.37
15 0.39
16 0.45
17 0.52
18 0.55
19 0.59
20 0.64
21 0.68
22 0.68
23 0.72
24 0.73
25 0.73
26 0.75
27 0.79
28 0.82
29 0.77
30 0.71
31 0.69
32 0.6
33 0.54
34 0.46
35 0.36
36 0.25
37 0.21
38 0.21
39 0.16
40 0.16
41 0.12
42 0.11
43 0.11
44 0.11
45 0.11
46 0.09
47 0.08
48 0.09
49 0.09
50 0.08
51 0.08
52 0.09
53 0.09
54 0.09
55 0.09
56 0.08
57 0.08
58 0.08
59 0.07
60 0.08
61 0.08
62 0.07
63 0.07
64 0.08
65 0.07
66 0.08
67 0.1
68 0.09
69 0.1
70 0.11
71 0.12
72 0.12
73 0.13
74 0.13
75 0.11
76 0.1
77 0.1
78 0.08
79 0.07
80 0.06
81 0.05
82 0.05
83 0.06
84 0.07
85 0.07
86 0.08
87 0.08
88 0.08
89 0.11
90 0.12
91 0.11
92 0.15
93 0.25
94 0.25
95 0.28
96 0.29
97 0.34
98 0.32
99 0.32
100 0.31
101 0.28
102 0.33
103 0.32
104 0.36
105 0.29
106 0.3
107 0.31
108 0.28
109 0.24
110 0.18
111 0.17
112 0.13
113 0.12
114 0.13
115 0.12
116 0.1
117 0.15
118 0.14
119 0.16
120 0.16
121 0.16
122 0.14
123 0.14
124 0.15
125 0.1
126 0.1
127 0.08
128 0.08
129 0.08
130 0.1
131 0.11
132 0.11
133 0.08
134 0.08
135 0.07
136 0.07
137 0.07
138 0.06
139 0.04
140 0.04
141 0.05
142 0.05
143 0.05
144 0.06
145 0.06
146 0.09