Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4FEG3

Protein Details
Accession A0A0C4FEG3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
75-94LRDNKTKISRPISRERRNKIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 12, mito 5, E.R. 3, vacu 3, cyto_mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDKFRPPFRARWCDLLLLLLFPVLIIVIIVVIVIIIGLGGVRVPLLLLALTPARFSLLSRSLRSVGHRVQFSEGLRDNKTKISRPISRERRNKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.45
3 0.35
4 0.26
5 0.21
6 0.14
7 0.11
8 0.08
9 0.07
10 0.04
11 0.03
12 0.02
13 0.02
14 0.02
15 0.02
16 0.02
17 0.02
18 0.02
19 0.01
20 0.01
21 0.01
22 0.01
23 0.01
24 0.01
25 0.01
26 0.01
27 0.01
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.03
36 0.04
37 0.04
38 0.05
39 0.05
40 0.05
41 0.06
42 0.06
43 0.1
44 0.17
45 0.21
46 0.22
47 0.25
48 0.26
49 0.27
50 0.31
51 0.32
52 0.3
53 0.32
54 0.32
55 0.31
56 0.33
57 0.35
58 0.33
59 0.34
60 0.34
61 0.33
62 0.35
63 0.36
64 0.34
65 0.38
66 0.42
67 0.41
68 0.44
69 0.49
70 0.54
71 0.59
72 0.68
73 0.72
74 0.77