Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4FCH9

Protein Details
Accession A0A0C4FCH9    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
54-80PTEAQKTHGRPKRNRLNKPKNYSPGPVHydrophilic
NLS Segment(s)
PositionSequence
62-73GRPKRNRLNKPK
Subcellular Location(s) mito 14.5, cyto_mito 9.833, nucl 8.5, cyto_nucl 6.833
Family & Domain DBs
Amino Acid Sequences MRPITKHTKEAALSTIDEIKAKLLAMNPAQLNMQLAAINQLLKGIGTVIDVKLPTEAQKTHGRPKRNRLNKPKNYSPGPVRVEHVEKKRQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.22
4 0.2
5 0.18
6 0.16
7 0.14
8 0.13
9 0.12
10 0.1
11 0.14
12 0.15
13 0.19
14 0.18
15 0.18
16 0.19
17 0.17
18 0.16
19 0.12
20 0.11
21 0.07
22 0.07
23 0.08
24 0.08
25 0.08
26 0.07
27 0.07
28 0.06
29 0.05
30 0.05
31 0.03
32 0.03
33 0.04
34 0.05
35 0.05
36 0.06
37 0.06
38 0.06
39 0.07
40 0.07
41 0.08
42 0.1
43 0.1
44 0.14
45 0.23
46 0.27
47 0.36
48 0.42
49 0.5
50 0.55
51 0.65
52 0.72
53 0.74
54 0.8
55 0.82
56 0.88
57 0.89
58 0.91
59 0.9
60 0.87
61 0.82
62 0.79
63 0.74
64 0.72
65 0.66
66 0.59
67 0.52
68 0.5
69 0.52
70 0.53
71 0.55